Identifiers and Description

Gene Model Identifier

Contig22168.0.g49

Standard Name

HSP90a

Aliases

Contig22168_0_g49

Description

Hsp90 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00183 ) Hsp90 protein
  • ( pfam02518 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam13589 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam11719 ) DNA replication and checkpoint protein
  • ( pfam10158 ) Tumour suppressor protein
  • ( pfam07423 ) Protein of unknown function (DUF1510)
  • ( pfam11801 ) Tom37 C-terminal domain
  • ( pfam02862 ) DDHD domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001585209.997093137033517e-262Hsp90 protein
SGDYPL240C9.997093137033517e-262HSP82 SGDID:S000006161, Chr XV
I from 98625-96496, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22168.0.g49(coding)
ATGTCAGAAGAAGTTTTTGCTTTCAACGCAGATATTCAACAATTGATGTCTTTGATCATC
AACACTTTCTACTCTAACAAGGAGATTTTCTTGAGAGAGTTGATCTCAAACGCCTCCGAT
GCCCTCGACAAGATCAGATACAGATCCATCACTGAGCCAGAGCATCTCGAGACTGAACCA
AACCTCGGAATCAAGATCATTCCAGACAAGTCCAACAACACCCTCACCGTCTGGGACTCA
GGTATTGGTATGACTAAGGCTGAGCTTATCAACAACCTCGGAACCATCGCCAAGTCAGGA
ACCAAGGCATTCATGGAAGCCATTTCAGCTGGTGCTGATATTTCTATGATCGGTCAATTC
GGAGTCGGTTTTTACTCCGCTTACTTGGTCGCTGAGAGAGTCACTGTTATCACCAAGAGC
AATGATGACGAGCAATTCAGATGGGAGTCCAACGCTGGCGGTACTTTCACCGTTGTCAAG
GATGAGGGAGAGAGAATCACCAGAGGAACCAAGATCATTCTCCACATGAAAGAAGATCAA
ATGGAAAACCTCGAAGAGAGAAAGCTCAAGGACCTCGTCAAGAAGCATTCAGAGTTCATC
GGTTTCCCAATTGAGCTCTACGTCGAGAAGAGTCAAGACAAGGAAGTTACCGAGTCTGAC
GATGAAGAAGACGCCAAGAAGGACGAAGAGGACAAGAAAGACGACGAGCCAAAGATCGAG
GAAGAAGAGAAGAAGAAGGAGAAGAAAATGAAGAAAATAAAGGAAGTCACCCACGAGTAC
GAACAACTCAACAAGACCAAGCCAATCTGGATGAGAAAGCCCGAAGATATCACCAAAGAC
GAGTACTCTTCATTCTACAAGGGTCTCAGCAACGATTGGGAAGATCACTTGGCCGTCAAG
CATTTCTCAGTTGAAGGTCAATTGGAATTCAAGGCTCTCCTCTTCGTTCCAAAGAGAGCT
CCATTCGATCTCTTCGAAACCAAGAAGAAGAAGAACAACATCAAGCTCTACGTCAGAAGA
GTCTTCATCATGGACGACTGTGATGAACTCATCCCAGAATGGCTTGGATTCGTCAAGGGT
GTTGTCGACTCAGAAGATCTCCCCTTGAACATCTCAAGAGAGACCCTCCAACAGAACAAG
ATCCTCAAGGTCATAAAGAAGAACATCGTCAAGAAGTGCCTCGAGATGTTCGCTGAAGTC
CAAGAGAACCAAGAAGACTACAAGAAGTTCTACGAGCAATTCTCCAAGAACTTGAAGTTG
GGAATCCACGAAGACTCAACCAACAGAACCAAGATTGCTGATCTCCTCAGATTCCACACC
AGCAAGACCGGTGACGATCTTATCTCATTCAAGGAGTACATCCAAAGAATGAAGGAAGGT
CAAAAGGACATCTTCTACATCACTGGAGAAAGCAGAGCTGCTGTTTCCAACTCACCATTC
CTCGAAGCCCTCAAGAAGAGAGGTTACGAAGTTCTCTACCTCGTTGACCCAATCGATGAG
TACATGGTCCAACAACTCAAGGACTACGATGGAAAGAAGCTCAAGTCATGCACCAAAGAA
GGTCTCGACCTCGAAGAGACTGAAGAAGAGAAGAAGCATCAAGAAGAAGAGAAGGCAAGA
TTCGAAACTCTCTGCAAGCTTATGAAGGACGTTCTTGGCGATAAAGTCGAGAAAGTTGTT
GTCAGCACCAGAATCGACGAATCACCTTGCGTTCTCGTCACTGGAGAGCACGGTTGGACT
GCCAACATGGAGAGAATCATGAAGGCTCAAGCCCTCAGAGACTCATCCATGACCTCTTAC
ATGATCTCAAAGAAGACCATGGAAATCAACCCAAGAAACCCAATCATCCAAGAACTCAGA
AACAAGGCTGAGGTTGACCAAAGCGACAAGACCGTCAAGGATCTCGTCTGGCTCTTGTTC
GACACTTCTCTCCTCACCTCAGGTTTCTCTCTTGATGAGGCCAACACCTTCGCCAGCAGA
ATCCACAGAATGATCAAGCTCGGTCTCTCCATCTTTGAAGATGACAAGCAAGAGGACGAT
GACCTCCCACCCCTCCAAGAATCAGATGCCCCAGCTGACAACAAGATGGAAGAAGTCGAT
TGA


>Contig22168.0.g49(protein)
MSEEVFAFNADIQQLMSLIINTFYSNKEIFLRELISNASDALDKIRYRSITEPEHLETEP
NLGIKIIPDKSNNTLTVWDSGIGMTKAELINNLGTIAKSGTKAFMEAISAGADISMIGQF
GVGFYSAYLVAERVTVITKSNDDEQFRWESNAGGTFTVVKDEGERITRGTKIILHMKEDQ
MENLEERKLKDLVKKHSEFIGFPIELYVEKSQDKEVTESDDEEDAKKDEEDKKDDEPKIE
EEEKKKEKKMKKIKEVTHEYEQLNKTKPIWMRKPEDITKDEYSSFYKGLSNDWEDHLAVK
HFSVEGQLEFKALLFVPKRAPFDLFETKKKKNNIKLYVRRVFIMDDCDELIPEWLGFVKG
VVDSEDLPLNISRETLQQNKILKVIKKNIVKKCLEMFAEVQENQEDYKKFYEQFSKNLKL
GIHEDSTNRTKIADLLRFHTSKTGDDLISFKEYIQRMKEGQKDIFYITGESRAAVSNSPF
LEALKKRGYEVLYLVDPIDEYMVQQLKDYDGKKLKSCTKEGLDLEETEEEKKHQEEEKAR
FETLCKLMKDVLGDKVEKVVVSTRIDESPCVLVTGEHGWTANMERIMKAQALRDSSMTSY
MISKKTMEINPRNPIIQELRNKAEVDQSDKTVKDLVWLLFDTSLLTSGFSLDEANTFASR
IHRMIKLGLSIFEDDKQEDDDLPPLQESDAPADNKMEEVD