Identifiers and Description

Gene Model Identifier

Contig9832.0.g37

Standard Name

HP1b

Aliases

Contig9832_0_g37

Description

Chromo (CHRromatin Organisation MOdifier) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • 3',5'-cyclic-nucleotide phosphodiesterase activity (IEA) | GO:0004114

Domains

  • ( pfam00385 ) Chromo (CHRromatin Organisation MOdifier) domain
  • ( pfam08499 ) 3'5'-cyclic nucleotide phosphodiesterase N-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002454100.000000019990673443141236heterochromatin protein 1, put
ative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9832.0.g37(coding)
ATGGTTAGGAAAAGTGGGAGAGCAGCTAACAATCCAGTGAGCATAGTGAATCAATATGTA
TATAACGAAGATTACATTCGAGAATTAATTGAGGAGGACAATACTTACGAGCCTTATCCA
ACTCTTCATCCCTCAGAAAAAGCTTAATTAGAAAGTGATCATGAAAATGATGCATCTATT
TTTACTGTAGAGAAGATTCTTGATAAAAAGAAGGAGGGCAGGAGGGTGTACTATATGGTG
AAATGGGAAGGGTTCAGTGAAGATCAGGCGACTTGGGAACCACTGAGTAATCTCCAGAAT
GTCAAAGAATTGCTGAAGGAGTTTGATAGACAGTATGAGCTTGGGAATATGAGCAATAAT
AGTCATAGTACAAGTATCTCAATGTCAAATAACTCTAACATAATAAACAGTATTAACAAT
CAGGAAATTAGTGCGTTATATTAATAGAGCCATAATATGGAGAGTTTTAGTAAAGATCAC
ATTGAATTTATTTGTCCAAAGAGTGCAGGGACAGAAAATATTCAGTATGCACAAAATCAA
GGCAGTTTAATTAGTTAGAGCAGCAAATCGATTAAGAAAGGGTGGTTAAAAAGAAATAGC
AAAACACTAATTGACTAAAATCAAAATTGTCGAGAAAATTTAGCAAGTCCTGTCAAAGTA
AGTTGCAACAAAAATGACAATTTAGCAATTGGTGGAATTAGATAGAGTTCAAGGCATTAG
TAATAAATGAGCAAGAAAATAATTGAAGAAGCAGATGAATAAATGTCTATTTTACTTAAG
CAAAAAGAGTTGATAGCTGTGTAGCAAGTACAAATTGAGGAATAATTACTTGTCTTAGAG
TCAATCAAGTCATTTAATTTATAAAGACAAAAAGAGTAAATTGAGAGACCTGATTAAGTT
CAAGGACTCCAGTAATAATAGGTTTCTTAAATTAATGAATAGAAATTAAGCAAAACTCCT
AAGAAATTGAAGAAAAAGCAAATATTGTCGCCAGTGAAAACCACGATTAAACCACCTGGT
AAAAGACCTGGAAGAAGAAAAAAGAATGTGATTGAGACTGAAACATTTCAAGATCACACA
GAACCTCTGGATGGTACATATGGTGTAAATAGTGAAGATATAAAAGACATAATAGATAAC
GAAGAACTTTAGCCTTACTTGTCATACCCTTAGCAAGGTTCCTTCGCAACAGATATACCT
TTGAGAATAAAAGGTGCTAAATTATTGGGATCTTAAATGATTTTAACAGTAGAATGGCAA
GAGAGGGAAAATGGGGAGAAACCTTTAGAACTTGAAATTGATAACACCTAGGCAAAAGAG
CTGTGCCCTAAAATATTAGCTGAGTTTTATGAATCTAAAATTCACTCTAGTAAAGTTTCG
CAGTTCAATTAATGA


>Contig9832.0.g37(protein)
MVRKSGRAANNPVSIVNQYVYNEDYIRELIEEDNTYEPYPTLHPSEKAQLESDHENDASI
FTVEKILDKKKEGRRVYYMVKWEGFSEDQATWEPLSNLQNVKELLKEFDRQYELGNMSNN
SHSTSISMSNNSNIINSINNQEISALYQQSHNMESFSKDHIEFICPKSAGTENIQYAQNQ
GSLISQSSKSIKKGWLKRNSKTLIDQNQNCRENLASPVKVSCNKNDNLAIGGIRQSSRHQ
QQMSKKIIEEADEQMSILLKQKELIAVQQVQIEEQLLVLESIKSFNLQRQKEQIERPDQV
QGLQQQQVSQINEQKLSKTPKKLKKKQILSPVKTTIKPPGKRPGRRKKNVIETETFQDHT
EPLDGTYGVNSEDIKDIIDNEELQPYLSYPQQGSFATDIPLRIKGAKLLGSQMILTVEWQ
ERENGEKPLELEIDNTQAKELCPKILAEFYESKIHSSKVSQFNQ