Identifiers and Description

Gene Model Identifier

Contig14595.0.g66

Standard Name

HP1a

Aliases

Contig14595_0_g66

Description

Chromo (CHRromatin Organisation MOdifier) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00385 ) Chromo (CHRromatin Organisation MOdifier) domain
  • ( pfam14061 ) Polycomb-like MTF2 factor 2

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001252800.000005000363240844623Pdd1p, a novel chromodomain-co
ntaining protei...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14595.0.g66(coding)
ATGGCGGGAGAAGCTCTTGAAGTGTATGAAGTATCTAAGATTCTTGGAAAGCGATTGAAT
GCAAAGAAATAAGTTGAGTATTTAGTTAAATGGATTGACTAGGCTGACTGTACTTGGGAA
CCATTTGAGAATCTCGCCACTTGCGCAAAATTGGTTGAAGAATTTAATCTATAAGAAAAT
GATACTGTAAAAGCTCTGCCTAAACCTCAAAATCATGAAATTTCGTAATTTCAAAGAAAG
AGAGATAAGAAGACAGCATTCAAGGAAGAAAAGGAGCTGTTACAAAATAAAGGATCTCTC
TAAAAGGGACATAAGATTTATAGAGTGATAGGTTTGTCTAAAAGTAGAAAAACTGGCTAA
CTATATGCAAAAGTAGAGTGGGAACCTGAAGAAAATGAAAAAAGCCTTCTTGAAGATTCA
TTTGTACCAGTAGATCTACTAAAGCAATCTTATCCTTAAATATTGCTAGCTTATTATGAA
TTTGAGAGCTGTATATTAGGAAATAAAAATGCTGAAAGATATGAGCTTTACACTGATTAC
TTTGTAAACACAAAAAGACAAAAACAGAAAAATTGA


>Contig14595.0.g66(protein)
MAGEALEVYEVSKILGKRLNAKKQVEYLVKWIDQADCTWEPFENLATCAKLVEEFNLQEN
DTVKALPKPQNHEISQFQRKRDKKTAFKEEKELLQNKGSLQKGHKIYRVIGLSKSRKTGQ
LYAKVEWEPEENEKSLLEDSFVPVDLLKQSYPQILLAYYEFESCILGNKNAERYELYTDY
FVNTKRQKQKN