Identifiers and Description

Gene Model Identifier

Contig14821.0.g10

Standard Name

HOP2a

Aliases

Contig14821_0_g10

Description

Tat binding protein 1(TBP-1)-interacting protein (TBPIP)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • negative regulation of transcription, DNA-templated (IEA) | GO:0045892

Domains

  • ( pfam07106 ) Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
  • ( pfam03965 ) Penicillinase repressor

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011904408.001486403440551e-25Tat binding protein 1(TBP-1)-i
nteracting prot...
SGDYGL033W0.00000000039982266684865623HOP2 SGDID:S000003001, Chr VII
from 435625-435679,43575...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14821.0.g10(coding)
ATGCCACCCAAGAAACAAAAACAAACTCAGTAAACATCTAATGACAACAACGACATCTCT
GACGTCTCAGCTGTCAAGAACCTTGAACAAACTGATGAAAAAGAGGAAGTAGTCTTGGAA
GACCACAGGAAATCTCAACTTTAAAAGCCAGGATCGAAGTAAACTGACAATACCAGGGCT
TCAACTCGTAATGGAGCAAGAAGGAAGTCAAGAGTCAACTATGCGGACAATTCATCTTCA
GAGGATGAGAAGGACGATGATGAACTTAATGATGAAGATTTCGCTGGAATATTTAGCAAA
TCAGTTGACTTGCAGGGTTCCAGGCAGAAAGAGGAGATTAAAGCAGTCACCAAGAAGGTT
CCCATGAAGCAGACTAACAGAAAAGTACTCAAGTCAAATGAAGGTGGAGATCTCAAACAA
GAAGCCAAAAAGTAAACTGCAGCTCAAGCAGCCAGAAACAAGTCTAAGCCTGTCTCTCAC
AAAGCTGATGACAGTGACGAAAGTGATGGGTAAGATGTTGGCAGTGACAGCGAGGAAGAA
AGTGATGGCTTTGACGACTCAAGTGACTAAGAAAGTGATGATTCAGATGAGGAGGAAAAG
AAAGGACCTTCCAATCCTAAATCAGCTAAGTCGAAGAAAAACGATAATGAAGAAGAGGAA
GTTAAAGCAAGCAAAAAGAGAACCAGAGATGGAAAGCCCAAGAAACCTCAACCTTCAGGA
AAAGACGCTAAGAAACCTGGAACATCAGCTTTAGGAGGTGGTGGGAAGGAAAAAGATGAT
GGAGGTAAGAAGATGATGACTGATAAGGAGGCACAAACAGCTATTCATTAGTACATGATC
AAACAGAACAGGCCTTATTCCGTGTAGAATGTCATCGATAACCTGCATGGCAGAGTGAAG
AAAGCATAAGCACAGAAGTTCCTTGATGAACTCTCAGACAAAAAGATACTCACATGCAAG
GAGTTTGGTAAAGCCAAGGTCTATCTTGCCAATCAGGATAACTTTCCAACCACGAGCAAT
GATGAATTGCTGAAACTTGATCTTGAAATCAAAGGACACAAGGATAAACTTCAACAGCAA
TAACTCAGATTGAAGGAAGTTCAAGCCTAGCTAAGAGACATCTAAATTACTCCTTCAAAT
GATTCTCTTGAAGCTGAGATTGCCAAGTATAAACAGCTTGTAAGGATAATTTCTTTCATT
CAAATTTAATTGAAGAATATTGATATTGGAGGAAGAATAGAGAAGTATGAAGCTGGAAAT
GTGAGAATGATCAGCGAAGAGGAAGTCAATGAAGCCAAATAGGCTATGTTGAAGTATGGC
AATGAGTGGAAGAAACGAAAGAGAGCTTGCATGGACATAGTTGATACGATTTGCGAGGGA
GCTGAGATGGGCAGAAAGGAGTTCTTTAATAAGGTATCTCTAGAACTTGATGAGGACTTC
AAAATAAACATCAACGATGTTCTCAATTGTTGA


>Contig14821.0.g10(protein)
MPPKKQKQTQQTSNDNNDISDVSAVKNLEQTDEKEEVVLEDHRKSQLQKPGSKQTDNTRA
STRNGARRKSRVNYADNSSSEDEKDDDELNDEDFAGIFSKSVDLQGSRQKEEIKAVTKKV
PMKQTNRKVLKSNEGGDLKQEAKKQTAAQAARNKSKPVSHKADDSDESDGQDVGSDSEEE
SDGFDDSSDQESDDSDEEEKKGPSNPKSAKSKKNDNEEEEVKASKKRTRDGKPKKPQPSG
KDAKKPGTSALGGGGKEKDDGGKKMMTDKEAQTAIHQYMIKQNRPYSVQNVIDNLHGRVK
KAQAQKFLDELSDKKILTCKEFGKAKVYLANQDNFPTTSNDELLKLDLEIKGHKDKLQQQ
QLRLKEVQAQLRDIQITPSNDSLEAEIAKYKQLVRIISFIQIQLKNIDIGGRIEKYEAGN
VRMISEEEVNEAKQAMLKYGNEWKKRKRACMDIVDTICEGAEMGRKEFFNKVSLELDEDF
KININDVLNC