Identifiers and Description

Gene Model Identifier

Contig22673.0.g97

Standard Name

HNT2

Aliases

Contig22673_0_g97

Description

HIT domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • UDP-glucose:hexose-1-phosphate uridylyltransferase activity (IEA) | GO:0008108

Biological Process

Domains

  • ( pfam01230 ) HIT domain
  • ( pfam11969 ) Scavenger mRNA decapping enzyme C-term binding
  • ( pfam04677 ) Protein similar to CwfJ C-terminus 1
  • ( pfam02744 ) Galactose-1-phosphate uridyl transferase, C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003787901.0004572433669413e-23HIT domain containing protein
SGDYDR305C5.999654353873483e-20HNT2 SGDID:S000002713, Chr IV
from 1073312-1072746,1073...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22673.0.g97(coding)
ATGGCACCAACCACCTATCGCTTTGGTGATTAATTGATCCCTCCCGAATAGGTATTCATC
TCAAGAAAGCACATCTATGCAATGGTATATGTGAAGGCAATTGTCCCTGGTCACGTGCTG
GTCTGCCCCATTAGATAAGTTTAGCATTTCAGAGATTTGACAGAGTTGGAAACCCTCGAG
TTGTTTGTTTGTGCAAAAGAGATCGCCAATAAATTCAAAGATTTCTTCAAAGTCAAGAGT
TTCAACTTCCTCATACAAGATGGAGACTAATCTGGATAATAGACTAAGCATGTGCATTTA
CATATAATCCCCAGAGAGGATACTCAGAGTAGTGTGGGCTAAATGAAATTAAATGTAGTA
ACAGAGAGAAGTCCTATAGATATGGCCGAAGAAGCTGATACACTAAGGCAGTTTTTTGAA
AAACGAGATGAAATAGTGCAGTTCAATTAGAGTAGTTACATTTGA


>Contig22673.0.g97(protein)
MAPTTYRFGDQLIPPEQVFISRKHIYAMVYVKAIVPGHVLVCPIRQVQHFRDLTELETLE
LFVCAKEIANKFKDFFKVKSFNFLIQDGDQSGQQTKHVHLHIIPREDTQSSVGQMKLNVV
TERSPIDMAEEADTLRQFFEKRDEIVQFNQSSYI