Identifiers and Description

Gene Model Identifier

Contig9222.0.g31

Standard Name

HNRNPMb

Aliases

Contig9222_0_g31

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam11608 ) Limkain b1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYCL011C7.000924640675686e-24GBP2 SGDID:S000000517, Chr III
from 103358-102075, Geno...
T. thermophilaTTHERM_004210000.0000000000499999055251093hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9222.0.g31(coding)
ATGAACTTTTAAAATTCTAATAGCAGACATAGAGACTATAATAATAGAAGGTAAAACATT
AGTAACGACAGAAGTAGAGATAGAGGTAGAAAATTTAATAAAATTAGATCAAATAGCTCA
AGGAGACATTCTGGCAAAAGAAGGGATAGGTCTTAAGAGGGCAACTTTTACTCTGTTAAT
AAATCTAGGAGAGATAATGATAAGAGAAATAGATCTACTTCTACTGATTATCAAAGCAGA
CGAGACTTCTCAGGTAGACCTAAGCAACGAGGTAAAGTTTATTGTAAGAGTAATCATTCT
TAAGTAGATTTTGGATATCCTTAGAACTACTAAGTGTCTAGAATGAATGAAGATATCGCA
AAAAGAATGCCATTGGAAAGAGAATAGTAAGGAGCAGGTTATAAGGTTTATGTAACAAAC
TTGGCTTTTGCAACTGATTGGAGATCATTGAAGGATCACATGAAGAAGTGTGGATTTGTA
GTGAGAGCAGATATCTTTGAGGATGATAAGGGGCGCTCCAAAGGTACAGGTGTGGTGGAG
TTTAGAAATTAAAACGATGCAATCAGAGCAATCAGAGAGGTAAATAGTACACAATTAGAT
GGGAGAACTGTCTATGTTAAGGAATATCATGAGCAAGGCAGCAGGAGCAGAGCTTAATAG
TCAATAAATTTACCTTAAGATGGCAGATACAATATCAGAGATGGCAGATACAATATCAGA
GATGGCAGAGATGGCTATTAAAAGTCAATGGATTTCATTCCTTTAAATCGTAATTAGAGA
AGTAGATCAAGGTCAAATCCAAAACGGTTCAATCCTCAAAATAGATTTGATGGTAGAGAT
AGAGAAAGAGATAGACAATAATCGTGTTAACTATCTAAGAGCATATACATCGGAAATTTG
CCTTATTCTGTCACTGCAGATTAACTAAGAGATGCGTTCCTCGCTTTTGGAAAAGTACTT
AATGCATAAATAGCAAGGGATGAGAAAGGAGGTTCCAAAGGCTACGGTTTAATAAAATTT
GAATCAAGTTTAAATGCTGAAAATGCTATAAAAGCAATGGATTAAGCCAAATTTAATGGA
AGGTAGGTCACAGTTAGATTCGATAGAGCAGATTGA


>Contig9222.0.g31(protein)
MNFQNSNSRHRDYNNRRQNISNDRSRDRGRKFNKIRSNSSRRHSGKRRDRSQEGNFYSVN
KSRRDNDKRNRSTSTDYQSRRDFSGRPKQRGKVYCKSNHSQVDFGYPQNYQVSRMNEDIA
KRMPLEREQQGAGYKVYVTNLAFATDWRSLKDHMKKCGFVVRADIFEDDKGRSKGTGVVE
FRNQNDAIRAIREVNSTQLDGRTVYVKEYHEQGSRSRAQQSINLPQDGRYNIRDGRYNIR
DGRDGYQKSMDFIPLNRNQRSRSRSNPKRFNPQNRFDGRDRERDRQQSCQLSKSIYIGNL
PYSVTADQLRDAFLAFGKVLNAQIARDEKGGSKGYGLIKFESSLNAENAIKAMDQAKFNG
RQVTVRFDRAD