Identifiers and Description

Gene Model Identifier

Contig17581.0.g107

Standard Name

HNRNPMa

Aliases

Contig17581_0_g107

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYCL011C0.000000000000020000882446601127GBP2 SGDID:S000000517, Chr III
from 103358-102075, Geno...
T. thermophilaTTHERM_004087400.00000019998969434520019probable RNA-binding protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17581.0.g107(coding)
ATGGAAGATAGAGAAGAGAAGTACAAATCACTTGAAGAATTGGTTAAGGAAGAGAGAGGT
AAAGGCGGTCATGGCGGCAAGCACTATCAAGCAGAGAATTCAACTAGAGGAGGTGATAGA
GAGAGACGTGACTTTAGAGATGACAGAGGAGGTCAAAGAAGAAGAAGAAGATCTAGCTCT
GGAGGTGACTTCAAAAGAGGTGGTGCTGGACATACTGGTTAAGCAGGCAGCAAGCTATTC
GTGAGCAATTTATCGTTTGACTCAACTTGGAAAACGATGAAGGACCATTTCAGAAAGTGT
GGGGACGTGATTCGTGCAGATGTTTTCGAAGATGACAGAGGAAGATCCAGAGGAATGGGA
ATTGTTGAGTACAAATATGCAGGAGATGCAATTAAGGCAATTAAGGAGCTTAATAACACT
ACTTTGGATGGTCGTTAGATCTATGTGAGAGAGGTGGGTAATTTTCGATGA


>Contig17581.0.g107(protein)
MEDREEKYKSLEELVKEERGKGGHGGKHYQAENSTRGGDRERRDFRDDRGGQRRRRRSSS
GGDFKRGGAGHTGQAGSKLFVSNLSFDSTWKTMKDHFRKCGDVIRADVFEDDRGRSRGMG
IVEYKYAGDAIKAIKELNNTTLDGRQIYVREVGNFR