Identifiers and Description

Gene Model Identifier

Contig875.0.g6

Standard Name

HNRNPDLb

Aliases

Contig875_0_g6

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam08777 ) RNA binding motif
  • ( pfam09726 ) Transmembrane protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOL123W1.9994498063102785e-22HRP1 SGDID:S000005483, Chr XV
from 87844-89448, Genome ...
T. thermophilaTTHERM_000239900.000000004999139696582238Splicing factor 3B subunit 4

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig875.0.g6(coding)
ATGGACTCTTAAAATTAATTGCTTTTACAGTAAGCTTTAGCCACTATGCAGTAGCATCCT
GGCGCTTTCTAGCCAGATTTTTCAGGCCAATCAGCCGATCCAAATAGCAGCACAGGAATT
AACAGCATGGGCTCAAATAGCGCACTTTTTGGAATGTTTTAAGTCCCTGGCCAAGGGGGG
TAACCTTAACCAAATTCTGCCTAGATGATGGGTGGAAATTCACTCGCAGCATTCGGAAGT
CACGACTAAAACTAACTAGGCGGGGTGCCATCCAATCAAGGAGGCAACAATTACGCAGAT
ATCATGAACTAGCTTTCGAAGCTACAGCAAATTGTTGGAAGCACAACTCAGAGTGGAGGT
ATGATGGGTGGAGCATCTGCGGTATCTAATACTTAAATGCCGGTAAGCAACTAAAGTAGT
AACAATTTGAACTAGAACTATGGTATTGTTGGTGGTATGAATGATTAGTAATAAACTAAA
TAGTCTTAGAATGTTGTTGGTAATGATTAATAGTAGTAGTAGATTATGAATAGTAATAAC
GCTAATACTTCTAATAATGCCAGTGGTAGTAATGGTTAGAGTGTTTAATAGTAAAGTTTG
AATTAGCAGCTTTAATCAAGTACAAACTAGTAGAATGCCGCTTTACTTGGGAGCATGCAA
AATGCTGCAGGAGCATCACTCAACCCTATGATGTAAATGAACTCTATGCTAAATCCCATG
TCTAATCCAATGGCTGCTGCTATGGGCATGGGTTTTTAAAATCCTATGATGGTCCCACCT
GCCGCGGGAGTTATGTTCCCTGGCATGATGGGAGGATCTATGGATATGAGTGGTGCTGGA
GGATACAATCCTTTCATGATGCCATTTATGAATCCTTAATTTATGGGAGGCAACTAAGGA
AATGTTGCCGCTTTTCATCAACAAGGTCCTAAAAATGAGATCAAGCTTTTCGTTGGAGGA
CTGTAATTCTAAACGATGGAACAAGATATGTTTGCCTACTTTTCTCAATTTGGAACAGTT
GGTGATGCCATAGTAATGAGAGACAAAAATACTGGCAGAGGTCGTGGATTTGGATTCATT
AGACTTATATTCAAAGATGATGATGAAGCCCAGAAAATGAAGGATCACATCATTAGACAA
AATAATGATCAATCAAGAGGCCACTTCATTTTGGACAAAAAGGTGGATGTGAAGTCAGCC
GACGACTATCAAGGTAAAACAAACTAAATGCAACCATAAATGAATAATCCATAAATGGGT
GGAAACCCCATGATTTAAAAACCTAATCCTTATGTGATTGCTGAGACTAAGACAAACGAA
CAAGAACCAGGTCATGTAGATGTCACTTTTAAGTATCCAAAAACAAAGATTTTTGTGGGT
GGTTTGGATTTTAAGCTTACAGTTGAAGAACTTAGACAACATTTCTAGTAATATGGAGAA
GTCACTGATTCTATAATTTTGAAGGATATCTACACAGGCTAATCAAGAGGTTTTGGATTT
GTTAGCTTTAAAGATGAGGATGTCGCTTAGAATCTTATTAATAACATATTGGTTACAACT
ATCAACGGTAGAAAAGCTGATATTAAAACAGCTGAGCCAAAGTTAAATCCCTTCATTCCA
TAAAAAGGTGGTCCTCACGGTGGAGGTGGCCATTAAATGTACGGTGGTGGTCCTCAAGGC
ATGATGCAATAAAATGGACCAGCAGTTATTCCTTAATATAGCTCAAGAGGAGGCGGCTAT
GATGAGCCTCATGGAGGTGGCCATTATGGACATCACTATGATAACAGAGCTGAATCACGA
GATAGAGGTGGAAGAGGTGGTTACAGAGATAGAGGAAATCATGACAACTATCGTAAAAAG
CCCATGAGAGGGTCACCAGATAGCTCTTAAGGTTCTTATGAACGTGGTGGAGGTGGTTTC
AGATCTAGATCCAGAAGTCCAGGTGATTTCAAAGGAGGTAGATTTGGTGCCGAAAGAGGA
GGCCGCCATGGCGGTGGTCGTGGAGGTCCAAAAGATTCCTTCAACAAAAGATATGATAGA
GATAGACATGAAGGAGGACAAGGAGCAGATTAAGACTTCAAGAAGCATAAAAAGAGTCAT
CGTGGAGATAGAGATGACAACAGCAGCTATAGAGGGAGTCCTGGCAGAATGGGAAAAGGC
GATTAAAGCCCGAAGATGAATAAGAAGAGAAATGCTTCAAATGAAAGAAGAAGATGA


>Contig875.0.g6(protein)
MDSQNQLLLQQALATMQQHPGAFQPDFSGQSADPNSSTGINSMGSNSALFGMFQVPGQGG
QPQPNSAQMMGGNSLAAFGSHDQNQLGGVPSNQGGNNYADIMNQLSKLQQIVGSTTQSGG
MMGGASAVSNTQMPVSNQSSNNLNQNYGIVGGMNDQQQTKQSQNVVGNDQQQQQIMNSNN
ANTSNNASGSNGQSVQQQSLNQQLQSSTNQQNAALLGSMQNAAGASLNPMMQMNSMLNPM
SNPMAAAMGMGFQNPMMVPPAAGVMFPGMMGGSMDMSGAGGYNPFMMPFMNPQFMGGNQG
NVAAFHQQGPKNEIKLFVGGLQFQTMEQDMFAYFSQFGTVGDAIVMRDKNTGRGRGFGFI
RLIFKDDDEAQKMKDHIIRQNNDQSRGHFILDKKVDVKSADDYQGKTNQMQPQMNNPQMG
GNPMIQKPNPYVIAETKTNEQEPGHVDVTFKYPKTKIFVGGLDFKLTVEELRQHFQQYGE
VTDSIILKDIYTGQSRGFGFVSFKDEDVAQNLINNILVTTINGRKADIKTAEPKLNPFIP
QKGGPHGGGGHQMYGGGPQGMMQQNGPAVIPQYSSRGGGYDEPHGGGHYGHHYDNRAESR
DRGGRGGYRDRGNHDNYRKKPMRGSPDSSQGSYERGGGGFRSRSRSPGDFKGGRFGAERG
GRHGGGRGGPKDSFNKRYDRDRHEGGQGADQDFKKHKKSHRGDRDDNSSYRGSPGRMGKG
DQSPKMNKKRNASNERRR