Identifiers and Description

Gene Model Identifier

Contig431.1.g125

Standard Name

HNRNPDLa

Aliases

Contig431_1_g125

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOL123W4.997543945741262e-17HRP1 SGDID:S000005483, Chr XV
from 87844-89448, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig431.1.g125(coding)
ATGTCTCAACCAAATCACGAACAGCAAGGTAAAATTTTTGTCGGAGGTCTATCACCCATT
ACAACTCAAGATAAATCAAGGGGCTTCGCATTTGTTATTATGAAAAATCCTGAAAATTTA
ATAAGAATTATTTCTCCTGATCTTTCTCATACAATCGATGACAAACAGATTGAATGCAAA
GTTGCCGTACCCAAAGATAAACTTGCCAAGCAACCTTAACCCAAAGCTAAAAATCTTGAC
TAAACATCCAAAAGTGAGGAGATCTCACAGGTTGGATAAGTTTAAATGGGAAGCTCAGAT
ACCAATTAAGAAATAGCTACCACATTTAATGATTTCTAGAATATCAGACAGTAAACCTTA
TAAATTAATGATTAGAAGGACTCAACTTAAGTATCTTCCAGTAGTGGATCAGAAACGATG
ATGTAAAGTGAATAAAAGCATGGAAACAAAAAGAAAGAGAACCAATACAGGAAGGTCATT
TATTAAGTGAAACAGTCTACACCCATCTAATAGTATTAAAAGGAGTTATCTTAGTTCCCA
GGGTAACTTAGCTCCAACGAGGATATGGACCTTCAATACTCTCCAGCCTACCCAGATTCA
GAACTATCTAATTCAAGAGGTTCTGTAAATCTTAAGAATGACGATCAACTTTCGTTAAGT
GGATCTGATAAAGCTCAATAAAATGAGCTGAACTAGCACTGGGATAACAGTCTTAAAGAT
GAAAGGACGACAAAGATCTTTGTCGGGGGCCTTACTCATGATGTCAACCAAGTCCAACTC
AAAGAATACTTCTCTACATTCGGCTAAGTTGAAGACTGCGTCATAATGGTCGACAAGAAC
ACGCAAAAATCGCGCGGCTTCGGATTTTTAACTTTCAAGTCAGATGACGCTGTCGACAGA
GTAATGGATCAGAAAGACCATCATTATATGAATGGAAAGTGGATCGATTGCAAGCGAGCC
AAACCAGTCAATCATCATACTCTCTAGAGAGCTAAGCAAGAAAAAATCACAAACTAGAAG
AAGGCGTCTCAAATTCAGCAAACTTAAAATAAGACCTCATCTCAACATATTCTAGAAAAG
TACGATAAAAACGACAGTAGAGATTCAAGTCATAATTCAACATTATAATATAATTAAATG
GAAATCTTTCAAAACAATTAAAAGGAAAATTCGAACTCTTCTATAAAACTAAGTTCTGAG
GAAGAAAAAAGTACCAGCTCTGGTTCACAGCAAAACAGGAGCGACTCTTTAGAAATGAAA
TAAAAGTACGGCTCCAGTAATTTATAGGGTTAGGGGAAAAATGCTGCCACAGAGCAGGCA
CCAAAGATTGACGGCTTTGAAAACTTGACTCCTGAACAACAGATGCAATTTAAAATCATC
ATGGATAAGTTGACCCAAGACTTTTTGCAAGCCTAGAACCAACAAAAATAACAGTAACAA
CAAAGCTAATTCTAATTCTAAGGTTAACCTAGGATGATGAACAATATTGTAAACCCACCC
CCATATTTTTATAATCCACCCTTTTAGCCACCAATGCAGCAATAGCAACAATAGTAGTTC
CCAATGTACTAGAACAATTAGCAGCCATAGTCGATGGGCTAATAACAATAATAACTTAAT
ATTTAATAGTAAAATCCATACTAATAATTTTAATAAAATTAATATCAACAAAGCCAATAG
TATGGACAGCCCATGTACAACTAACAATAAAATTTTGGTCAAAATGGTAACAACATGTAC
ATGTCCCAACAGAACAATAACTATCAGCAACAAAACTAACACATGAATATGTAAAACATG
AATAACATGGGAATGAATCAGTACCAAGGAGGTAATAACATGAATTTTGGACAGAACAAT
AACAGTAACTACAACCAAGGCAATTATGATAATATGGGCTACAACTAAAACAACAACATG
AACTACAACTAATAAAACATGAACTACAATCAGAATAACAACGGTATGAACAACAACTTC
AATAGATACCCATAGTAGTAGCAGAACTAATACTAGTAGCCCTAACAGTTCAACGGATAC
TAAAATCAGTAAATGCAACACTCCAACAATTTCTCATAAGGGCAGTAGTAAAATCAAAAC
TACAACTAGCAATTCCAAAATGCCTTCAACAATTTGAACTTGAACTCCTAGGCTCAGCAA
AACTAGTATGATCAAAATGGAAATAATATCCAAGGAACCCAATCGGTACATTCAGACTCA
AGCGCCTCAACTCAGGCATATAGTCCTTAACTATCATCAAACTTTGATGACAAGAAAGTC
TTACCTTAATACCAGAATCAGCATGATATTCCAAAATGCTCATCATAAAATAACTTCAGC
TACTAGAACAGATCAAACGAGAATATATAGTAGCACCAATTGAACACTTCAGGAAACAAA
GATCCCAACTCTGTTCCCTAGTAAAGTTTCAATCAAGCTTTTGCTAATGCAATTGTTAAC
GGCTAGAACAACAAAAGCTAAAATAACTCAAGGGACAATATTCCCAATCAAAACCAAACA
GTTAACAATACATAAAACTCGTATTAGCCTTTGTTCGACAATCTCTTCTAGAACTTCCAG
TCTCTTCTTTCTAAACCTAAAGACGGACAAAATCCAGGAGAGTCTTAATTGGATCTCTAA
CTTGATGGCAGCATGGAGAGCTTAATGATTGATACCTCATTCTTAAGTCAGAATTCTTTT
TTCAACAACTCCCATGATCTCAGTCAAGAAATTATTGCTCATATTTAGAACACTCAGCTC
AACAAGCAAAAGAAGAAAGAGATTACTTAGGCTCTTCAGAATCAAACCTAAAGTTTACAG
TAGTAGCAACAACAGTAGAGCTTCATAGATCATGTGCAAACTCTAAACAGTATAGTTGAC
TAAATTGTTTCTAAGCCTTAACAGTAAGATATGCAATAGCAAAACCAATCTTCTTAACAG
TTCTAATTCCAATCTATGCTTAACTAAAGCAACTTCCAAAACTCATAATAATAGCAACAA
AAACCATAATCCTTCATGAGCTTTGATGACTATCAAAATAAACAGTAGCAGGCAATCAGC
AAAAACACGAGCCCAAATGAAACCTTTGTGGCATCCGACGGATCAACTTCTAAATAGTAA
TTCGGTCCAGCAAGATCAAATAAGCAACCCGTTTAGCCTAGTCGCTTACAAGATCGCGCC
TACAAGCCATATTGA


>Contig431.1.g125(protein)
MSQPNHEQQGKIFVGGLSPITTQDKSRGFAFVIMKNPENLIRIISPDLSHTIDDKQIECK
VAVPKDKLAKQPQPKAKNLDQTSKSEEISQVGQVQMGSSDTNQEIATTFNDFQNIRQQTL
QINDQKDSTQVSSSSGSETMMQSEQKHGNKKKENQYRKVIYQVKQSTPIQQYQKELSQFP
GQLSSNEDMDLQYSPAYPDSELSNSRGSVNLKNDDQLSLSGSDKAQQNELNQHWDNSLKD
ERTTKIFVGGLTHDVNQVQLKEYFSTFGQVEDCVIMVDKNTQKSRGFGFLTFKSDDAVDR
VMDQKDHHYMNGKWIDCKRAKPVNHHTLQRAKQEKITNQKKASQIQQTQNKTSSQHILEK
YDKNDSRDSSHNSTLQYNQMEIFQNNQKENSNSSIKLSSEEEKSTSSGSQQNRSDSLEMK
QKYGSSNLQGQGKNAATEQAPKIDGFENLTPEQQMQFKIIMDKLTQDFLQAQNQQKQQQQ
QSQFQFQGQPRMMNNIVNPPPYFYNPPFQPPMQQQQQQQFPMYQNNQQPQSMGQQQQQLN
IQQQNPYQQFQQNQYQQSQQYGQPMYNQQQNFGQNGNNMYMSQQNNNYQQQNQHMNMQNM
NNMGMNQYQGGNNMNFGQNNNSNYNQGNYDNMGYNQNNNMNYNQQNMNYNQNNNGMNNNF
NRYPQQQQNQYQQPQQFNGYQNQQMQHSNNFSQGQQQNQNYNQQFQNAFNNLNLNSQAQQ
NQYDQNGNNIQGTQSVHSDSSASTQAYSPQLSSNFDDKKVLPQYQNQHDIPKCSSQNNFS
YQNRSNENIQQHQLNTSGNKDPNSVPQQSFNQAFANAIVNGQNNKSQNNSRDNIPNQNQT
VNNTQNSYQPLFDNLFQNFQSLLSKPKDGQNPGESQLDLQLDGSMESLMIDTSFLSQNSF
FNNSHDLSQEIIAHIQNTQLNKQKKKEITQALQNQTQSLQQQQQQQSFIDHVQTLNSIVD
QIVSKPQQQDMQQQNQSSQQFQFQSMLNQSNFQNSQQQQQKPQSFMSFDDYQNKQQQAIS
KNTSPNETFVASDGSTSKQQFGPARSNKQPVQPSRLQDRAYKPY