Identifiers and Description

Gene Model Identifier

Contig21125.0.g67

Standard Name

HMT1c

Aliases

Contig21125_0_g67

Description

Methyltransferase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13847 ) Methyltransferase domain
  • ( pfam06325 ) Ribosomal protein L11 methyltransferase (PrmA)
  • ( pfam13659 ) Methyltransferase domain
  • ( pfam12847 ) Methyltransferase domain
  • ( pfam05185 ) PRMT5 arginine-N-methyltransferase
  • ( pfam08241 ) Methyltransferase domain
  • ( pfam13649 ) Methyltransferase domain
  • ( pfam05175 ) Methyltransferase small domain
  • ( pfam01170 ) Putative RNA methylase family UPF0020
  • ( pfam08003 ) Protein of unknown function (DUF1698)
  • ( pfam02475 ) Met-10+ like-protein
  • ( pfam13489 ) Methyltransferase domain
  • ( pfam02353 ) Mycolic acid cyclopropane synthetase
  • ( pfam10294 ) Putative methyltransferase
  • ( pfam13578 ) Methyltransferase domain
  • ( pfam13679 ) Methyltransferase domain
  • ( pfam03848 ) Tellurite resistance protein TehB
  • ( pfam08242 ) Methyltransferase domain
  • ( pfam01135 ) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
  • ( pfam01728 ) FtsJ-like methyltransferase
  • ( pfam01209 ) ubiE/COQ5 methyltransferase family
  • ( pfam03602 ) Conserved hypothetical protein 95
  • ( pfam01596 ) O-methyltransferase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002194909.998496826795377e-105hypothetical protein
SGDYBR034C2.000234809436283e-103HMT1 SGDID:S000000238, Chr II
from 305976-304930, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21125.0.g67(coding)
ATGATTCCTAACGATGGTGAAGGTCAATTCTAAATCCCTCCCTTCAAACACTTGAACAAG
AAATCAGATGAGGAAGGTTTTGAAGGATATGACTCTTCTAATTGGTTCAACGAAGAAGAT
TTCAAAAAGACTGTGATTGCTCCTATGCATGCAGAAGACCCAACTGATTTATACTTTGAT
AGCTACTCGCACTACTATATTCACGAGGAAATGATTAAAGATCATGTTAGAACTTCGAGT
TACGAGAAAGCAATGATGAAAAATAGTGAAGTACTCAAAGATAAAATTGTGCTTGATATT
GGGTGTGGTACTGGAATATTAAGCATTTTTGCAGCTAGAGCTGGGGCAAAGCATGTTTAT
GGAATTGATAACGCTGAGATTGCAGAGTATGCAAAACACATTGTAAAAAAGAATGGGTTT
GCAGATAAAATCACAATCATTAAAGGTAAAGTAGAAGAGATTGAGTTACCAGTTGAGTAA
GTTGATGTAATTATATCAGAGTGGATGGGCTATTTTTTACTGTATGAAAGCATGTTAGAT
ACAGTCTTATTTGCAAGAGACAAGTGGCTAGTTAAAGATAAAGGAATAATTATGCCAGAC
AAGTTTAACATGTTTATAGCCGGATTCGAAGACAAATTTGGTTTCAAGACAAGCAAGTAA
GTATTCTGGAAAGAAGTATATGGTATTGATATGGAAGAAATTGGAAATCTAATTTACATA
GAACCCACTGTTGAAGCTATTGAAATGAAACAAATCAAAACAGATGTTTGCACATTTTAT
TCATTAGATTTGAACACTTGCAAGAAGGAGGATGCAGTATTTGCTAATAAATACTGTATT
ACCATGCAATAAGAAGGGAAAATTGATGGGCTAATTACATGGTTTGATTGTGAATTTAGG
CACAATTTGAAAGTGCCGTTAAGATTCACAACTGGTCCATTCACTCATGTAACCCATTGG
AAACAAACACTTTTTTACATAGATGGAGAGTATGATCTTGAGAAGGGAGATAAGATGTTT
GGCTCATTAGCAATCAGGAAAAACAAAAAGCATCCTAGAGAGTTAGACATTAAGATATCA
TTTAATTGTTAAGAAGATAATGGACAAGAAATAGGTGAAAGATACATTTAATACTTTCAA
ATGACTTGA


>Contig21125.0.g67(protein)
MIPNDGEGQFQIPPFKHLNKKSDEEGFEGYDSSNWFNEEDFKKTVIAPMHAEDPTDLYFD
SYSHYYIHEEMIKDHVRTSSYEKAMMKNSEVLKDKIVLDIGCGTGILSIFAARAGAKHVY
GIDNAEIAEYAKHIVKKNGFADKITIIKGKVEEIELPVEQVDVIISEWMGYFLLYESMLD
TVLFARDKWLVKDKGIIMPDKFNMFIAGFEDKFGFKTSKQVFWKEVYGIDMEEIGNLIYI
EPTVEAIEMKQIKTDVCTFYSLDLNTCKKEDAVFANKYCITMQQEGKIDGLITWFDCEFR
HNLKVPLRFTTGPFTHVTHWKQTLFYIDGEYDLEKGDKMFGSLAIRKNKKHPRELDIKIS
FNCQEDNGQEIGERYIQYFQMT