Identifiers and Description

Gene Model Identifier

Contig651.1.g15

Standard Name

HMT1b

Aliases

Contig651_1_g15

Description

PRMT5 arginine-N-methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002194904.997910161537908e-106hypothetical protein
SGDYBR034C1.9992138342796362e-97HMT1 SGDID:S000000238, Chr II
from 305976-304930, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig651.1.g15(coding)
ATGAGAGGCGGGAAACAATTAAAGAAAAGAACCTAAGCAGGATCACCCAAAAAGCAAGCA
GCAAATAAATCTAAATCAGTCGCCATGAAATCAGAGGCTGTCTCTAAAAGAAAATAAACC
CCAAAATAAGTTCAGTAAAAAACCAAGTAAATTAAGAAAACTAAGGCTATAAAAAAGCCC
ATAATAGCAAAGTCAAAACCATAAAAGCAAACCAAAGCTAAAAAAATTACTTAGAAAGCT
GCCAAGATAACTCATAAAAATGTTGCTAGCAAAGTCAGCTCATAAATGATCACTTCTCAA
AAGAAAAAGTCATTAATTAAGCAATCTTTATCTGGGAATAAATCTCAATCAATCAGGCTT
CTATCTCATTAACCATCAACTGAACAAGGTTTTACTGGATCTCCTACAAATTGGTTTGAT
GATAACGAGTTCTTCTAATCTTTGTGCGCTGACTTAAAAGACCACAAACACGATTACTAT
TTCAACAGCTACTCAAACTTCTACATCCATGAAGAAATGCTCAAGGATAAAGTGAGAACT
GAAGCCTATAAGAAAGCTATTGACTTGAACAGACACTATTTCCAGGGTAAGACTGTAATG
GATATTGGATGTGGAACTGGTGTCTTGAGCATATTTGCTGCAAGAGCAGGTGCCAAGAAA
GTATACGCTGTTGAAAATGCTGAAATTGCTTATTTCGCACAAGAAATTATAAAGCAAAAC
GGTTTGAGTAAAGTTATTACAGTTCTGAAAGGCAAAGTTGAAGAAGTCAAGATTCCAGAA
AAGGTGGACATTATTATCTCAGAGTGGATGGGGTATTTCCTACTGTATGAGAGCATGCTT
GATTCTGTACTATGGGCCAGAGACAAATACCTAAAGCCTAATGGCAAGATGTTCCCTAAT
CGTGGATAATTGTTTGTTGCAGCTATTGAAGACGCCAAGTTCAAAGAATCTAAAGTAGGT
TTCTGGAAAAACATCTATGGTATTGATATGAGTTGTATGGCCCCAACAGTCTTAAGAGAG
CCTTTGATTGACATATTAGATTCAAAGTCCATTACATCTAGCAACCACAAACTTATCGAC
CTAGATTTTGATCATATGGACAAAAAAGAAGTTGAGTTCTCAACAACCTACAAAGTTACT
TTCCAAAGAAATGACAAATTCCATGGACTCGTTTCTTGGTTTGATACTTTGTTCTCAAAT
ATGACACATGAAGTAAATCTTTCAACGTCTCCATATGGCAAACCAACTCACTGGAAACAA
GTCACATTTTATACTGATCATAACTTAAAGGTTCAGAAAAATGATACTTTAGAGGGATCA
ATTGCTGTCAAACAATCCAAAACTAACTTCAGGGAGCTAGACGTGAAAATTAGTTTTCAT
TTCAACCTTAAAAAACCTCAAGGGCAAACAACTGATTTCGTGTAACTTTACAAAGTTAGA
TGA


>Contig651.1.g15(protein)
MRGGKQLKKRTQAGSPKKQAANKSKSVAMKSEAVSKRKQTPKQVQQKTKQIKKTKAIKKP
IIAKSKPQKQTKAKKITQKAAKITHKNVASKVSSQMITSQKKKSLIKQSLSGNKSQSIRL
LSHQPSTEQGFTGSPTNWFDDNEFFQSLCADLKDHKHDYYFNSYSNFYIHEEMLKDKVRT
EAYKKAIDLNRHYFQGKTVMDIGCGTGVLSIFAARAGAKKVYAVENAEIAYFAQEIIKQN
GLSKVITVLKGKVEEVKIPEKVDIIISEWMGYFLLYESMLDSVLWARDKYLKPNGKMFPN
RGQLFVAAIEDAKFKESKVGFWKNIYGIDMSCMAPTVLREPLIDILDSKSITSSNHKLID
LDFDHMDKKEVEFSTTYKVTFQRNDKFHGLVSWFDTLFSNMTHEVNLSTSPYGKPTHWKQ
VTFYTDHNLKVQKNDTLEGSIAVKQSKTNFRELDVKISFHFNLKKPQGQTTDFVQLYKVR