Identifiers and Description

Gene Model Identifier

Contig11440.0.g14

Standard Name

HMT1a

Aliases

Contig11440_0_g14

Description

Ribosomal protein L11 methyltransferase (PrmA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002194903.001222955304439e-106hypothetical protein
SGDYBR034C1.9995541014149208e-99HMT1 SGDID:S000000238, Chr II
from 305976-304930, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11440.0.g14(coding)
ATGGAGTCATCATAAGACAAGAAATATGTTCAAAAGGGCAGCAAAGATCAAAAGGTGTAT
GCCAAGAAAGGCAATTTCCCAAGACCCTCTACTGAGGAAGGATTCACTGGAACCCCAGAG
ACCTGGTTCGATGATGAGGAATACAAGAAGCAATTAGGAGATTTGATTGCAGATAAAGAT
CCAAATCACGATTACTATTTCGGAAGTTATTCAAGCTCATACATCCACGAAGAGATGCTA
AAGGACAAGGAGAGAACATTGGCATACAAAAGAGCCATCGAGAGAAACGGAGATGACTTC
AAGGGCAAAATTGTTATGGATATTGGAGCTGGAACTGGTATTTTGAGTATTTTCGCTGCA
AGAGCAGGAGCTGCTCATGTTTACGCCATCGAGAATGCCGAGATCGCATACTACGCTAGA
GAAATTATCAGAAAGAACAATTTAGCTGATAAGATTACTGTATTAAAGGGCAAAATGGAG
GAAATTGAATTACCAGTACCAAAGGTTGATATTATTATTTCAGAGTGGATGGGATATTTC
TTGTTATATGAGAGCATGCTTGATACCGTTCTATGGGCAAGAGACAAATATCTTGTTGAA
GGTGGCAAAATGCTACCAGACAGAGCAAAGATCTTCTTGGCTGCTATCGAAGACGCTCAA
TACAAGTATCAGAAGACTGCTTTCTGGGATGATGTGTATGGTGTTGATATGTCATGCATG
GCAGGAAGCTTCATAAATGAACCATTAATTGACATTTGCAATGGTGACATGATTATTTCA
AACGAATGCAAGATTCTTGATTTGAATCTCTGCACCATGGACAAGGGTGATGTCGAATTC
ACCTCAGAATATGAAATTACATTCAACTGCAATGATAAATGCCACGCTTTAGTCTCATGG
TTCGACACTGACTTCAGAGACCTATAAAACCCTATTGTTCTTACCACCTCCCCATACTGC
ACTTCCACTCACTGGAAACAAGTTGTTTTCTATATGAATCGTGAGCTCAACGTTCGCAAA
GGAGAAGTCCTCAGAGGTTCAATTGCTGTTAGAAAGAGCAAGGCTAATTTCAGAGAAATT
GATGTTAAAATTAGCTACCACTTCGAAGGATCACAGTGCAAAGAGAACTTCACTCAATTA
TACAAAGTCAAGTGA


>Contig11440.0.g14(protein)
MESSQDKKYVQKGSKDQKVYAKKGNFPRPSTEEGFTGTPETWFDDEEYKKQLGDLIADKD
PNHDYYFGSYSSSYIHEEMLKDKERTLAYKRAIERNGDDFKGKIVMDIGAGTGILSIFAA
RAGAAHVYAIENAEIAYYAREIIRKNNLADKITVLKGKMEEIELPVPKVDIIISEWMGYF
LLYESMLDTVLWARDKYLVEGGKMLPDRAKIFLAAIEDAQYKYQKTAFWDDVYGVDMSCM
AGSFINEPLIDICNGDMIISNECKILDLNLCTMDKGDVEFTSEYEITFNCNDKCHALVSW
FDTDFRDLQNPIVLTTSPYCTSTHWKQVVFYMNRELNVRKGEVLRGSIAVRKSKANFREI
DVKISYHFEGSQCKENFTQLYKVK