Identifiers and Description

Gene Model Identifier

Contig9501.0.g55

Standard Name

HMGB1j

Aliases

Contig9501_0_g55

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam09011 ) Domain of unknown function (DUF1898)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002160400.000000000010004361180063202HMG box family protein
SGDYBR089C-A 160.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9501.0.g55(coding)
ATGGATCAGCTGTTTTCGATTTTCGCTGAGTTTTTCGGAAAACTTAGGACTGTCCTAAAT
GAAAACGCAAATGAAAGCAACAGTCAACTGTCAAATCTTAATGATGGTAAAAAGTCAGTG
AGGAAGAAGGAGCCAACTAAGGACAAGTCAAAATAAACACCCCTCAATTTTGCAAGCATC
AATAATAACCAAGTTTCTAAAAATAATAAAGCATCAATCTAACACTAGTAAGCAATTCCC
ACAAACGATGCTGAGAGCTCTAATAAGAAGAAGGTGAGATCAAAGTAAACAGTGTTGATG
AATCCAGTAGTGGCTGATAAAACTAAAGCAATTAAAAAGTAAAAAGACAAAAATGCACCC
AAGAAACCTCTGTCAGCATTTATGCTCTATAACAACTTTAGAAGACCCTAAGTTAAGAAA
GAAAATCCATAATTGACTCTACCTGAGACATCAAAGGTCATCGGAGAAGAATGGAATAAA
CTTAGTGAATCTTAGAAGAAGATTTGGCAAGAAAGGGCCAGGAAGGCGAAGCTTAATTAT
GAATTATTACAGTATCAATAAGTGTCTAGACAAGAAAAAAGTATTAAGTACAGAACTGAG
GCTGACTATAGTGACAACGAAACTACAGCGAAATCTTAATCAACGATAGTCCCACACTCA
GATCACGCCTCTAATCATAAACCCAAACCCTCAGCAAGCCTTGGCAAGCCTCACACCTAG
AACTTGCTTTCATAGAGAGCAACTTTAGACAAGCAATCATAAGACATAGCAAAGCGTCAA
AACGATCTGAAAAAGTAACTTCCATTCCTAGAGACTCAGCCAAAGATTAAGAAACAGCCT
GATTTGAACAGTGGTTCTGGCTCATCGTCACTTGAAGACTCTGGGGAATCTTCGCAATTA
AGCGCTGTCAATAACAACAAACAGGTTGAAATGATCAAGCAGCAGTAAGCATCTTCAAAA
GTACCTATCAAGAAACAATTTCCAGATTCTGATTGA


>Contig9501.0.g55(protein)
MDQLFSIFAEFFGKLRTVLNENANESNSQLSNLNDGKKSVRKKEPTKDKSKQTPLNFASI
NNNQVSKNNKASIQHQQAIPTNDAESSNKKKVRSKQTVLMNPVVADKTKAIKKQKDKNAP
KKPLSAFMLYNNFRRPQVKKENPQLTLPETSKVIGEEWNKLSESQKKIWQERARKAKLNY
ELLQYQQVSRQEKSIKYRTEADYSDNETTAKSQSTIVPHSDHASNHKPKPSASLGKPHTQ
NLLSQRATLDKQSQDIAKRQNDLKKQLPFLETQPKIKKQPDLNSGSGSSSLEDSGESSQL
SAVNNNKQVEMIKQQQASSKVPIKKQFPDSD