Identifiers and Description

Gene Model Identifier

Contig8508.0.g90

Standard Name

HMGB1i

Aliases

Contig8508_0_g90

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) (IEA) | GO:0000276
  • extrachromosomal circular DNA (IEA) | GO:0005727

Molecular Function

Biological Process

Domains

  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam09011 ) Domain of unknown function (DUF1898)
  • ( pfam01076 ) Plasmid recombination enzyme
  • ( pfam05873 ) ATP synthase D chain, mitochondrial (ATP5H)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR089C-A 150.8

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8508.0.g90(coding)
ATGAGTGGAATGAAAATGCCGTTTATAAGATAAAGCAGAGGTAGATCAGCAAGAGATAAA
ACTAAGCCAGATCCTATAATGACACCTTGGAGAGCGTTTTGTTCTGAAAACAGGCCTATA
TTTGTCAATGATAACCCTGATTTAGACTATCATGAAATTAAAACTCTCCTTCAGGATGTT
TGGGATGTGTTAGATGATGACTAAAAACAATACTATGAACAAAAATCAAAAGATGATAAA
TGGCGATTCCTTGAAGAATGGGAAGCCTGGTTAAGGTAAAGATTTGCTTCCATCATGCCT
ATTCTTCCTGAAAAATTTCCTTAACCACCACTAAGGGCTAAGAACGGCTTTAAAGTTTTT
GGAGAAGCTTAGAAAGAAAGTTTTTTAAAGCTAATGCCAGAGAGTCAAGTTGAGATAAGA
CTTTGA


>Contig8508.0.g90(protein)
MSGMKMPFIRQSRGRSARDKTKPDPIMTPWRAFCSENRPIFVNDNPDLDYHEIKTLLQDV
WDVLDDDQKQYYEQKSKDDKWRFLEEWEAWLRQRFASIMPILPEKFPQPPLRAKNGFKVF
GEAQKESFLKLMPESQVEIRL