Identifiers and Description

Gene Model Identifier

Contig12963.0.1.g3

Standard Name

HMGB1h

Aliases

Contig12963_0_1_g3

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007847100.0000009995106777214876HMG box family protein
SGDYBR089C-A 168.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12963.0.1.g3(coding)
ATGAGCAATTTAGGGACTGGGGATTCAGAAATAACATTCTCAAACGTCACAGGTGACTTA
CAATCTCAAGTATCATGCTCGCTCGAGGATAATAGTGCTTATCACAGCAGATAGTAGAAG
ATTCTTGACGCTATGAAGGATGCGCCAGGAACTAAACCTATCAGTTTTTATGAAGAATCA
CAAATTGCTAAAATCTATGGAATGACTGAAGATTACACTCCTCCTAATCGTACAAAATCT
GCTTATCAAATTTTCACTGAACATAAAAGGGAAGAGTTATTAGAAGAAAAACCAAACATG
ACTTTAAATGAATTGACTAGAGAAATAGCTAAACACTGGGCAAGATTGGATAATGATTAA
AAAGCACGATTTGTGGAAGAATCAGCAAAAGATAAGGAAAGATATATAAATGAAATGAGA
AATTTGCCAGTACCCCTATATAGAAACAAGAGACCAAGAAGACCAAGAGACAGAAGAAAA
CCAAAGAAAGTCTTAACACCCTATATGTTTTTTGTCAAAGAAAATAGACCTAGAATCATG
CGAGAAAGTCCGAATATGACATTTCTTGAAGTAATGAGAGAAGTGGGAGTAAGATGGAGC
AAATTAAGTGAAGTAGAAAAGGAGCCATTTAAAGAGAGATCATTAGAAGACAAAAGAAGA
TTTTTAGAAGAGCAAGAGGTGTTTATCAGATAAAGATTCGCTTTCCCTTCAAATACTTTT
GATCAAAGACTTGCTTAAGGATAGCCACAACAAAAAAGACCAATAACTGGTTTCTAAATG
TACTTAAGAGAATTAAGAGAGAAAACAAAGAAAGAAAATCCAAAATTATAAATGGGTGAA
TTTATGAAGCAAGCCTCAATGAACTGGACTAGAATGAGTCAAAAAGAAAAGAAGATGTAT
GATCATATGGTTGAAAAGGATCGAAATAGATATGACGAGAAATATCAAGATTTTAAAAAG
CAATAGACCATGCAAATGGATATACCTGACTCACAAGCTTTATCTATGATGGGTGCTTCT
GATACTTTTTCAGAAATTGATAGTGGTTATATCTTAAATAAGGATGAATTGAGTTAAATG
ACGTGTAAAACTCACAAATCACTAAATAGAATTGCCAAATTTGATCAGATTTAAAGTGGA
GATAGTAAAAATAAAAGTTTAGACTTTACAAGCAAGTGTAAATTGCTTAAAAATGGTGCT
ATAAAATTTAACCCAGAAGATAATGACGAAGACTCTGATATTTAATTAGATTGA


>Contig12963.0.1.g3(protein)
MSNLGTGDSEITFSNVTGDLQSQVSCSLEDNSAYHSRQQKILDAMKDAPGTKPISFYEES
QIAKIYGMTEDYTPPNRTKSAYQIFTEHKREELLEEKPNMTLNELTREIAKHWARLDNDQ
KARFVEESAKDKERYINEMRNLPVPLYRNKRPRRPRDRRKPKKVLTPYMFFVKENRPRIM
RESPNMTFLEVMREVGVRWSKLSEVEKEPFKERSLEDKRRFLEEQEVFIRQRFAFPSNTF
DQRLAQGQPQQKRPITGFQMYLRELREKTKKENPKLQMGEFMKQASMNWTRMSQKEKKMY
DHMVEKDRNRYDEKYQDFKKQQTMQMDIPDSQALSMMGASDTFSEIDSGYILNKDELSQM
TCKTHKSLNRIAKFDQIQSGDSKNKSLDFTSKCKLLKNGAIKFNPEDNDEDSDIQLD