Identifiers and Description

Gene Model Identifier

Contig4075.0.g7

Standard Name

HMGB1e

Aliases

Contig4075_0_g7

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKL032C0.00000000000008999700526206354IXR1 SGDID:S000001515, Chr XI
from 381858-380065, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4075.0.g7(coding)
ATGAACTAATACAAAGCAACAACCTCAAATTTCATGCTCTACAATCCTTAAGATGAAGAA
GCGGATAGTCTGATAGAAGAAGAACTAAAAAATGAGTTCATAGAAGAAGAGACTATCACT
GACAAAGAATTTCAAAGAGCCATGTAAAAGCTCAAAAACAGAGGTTTAAATGCAGTTCCA
CCCAAGAAATCAGCCTCAGCCTATATAATATTTGGAAAAGAGAAAAGAGAAGAAATTATT
AAGAAGAATCCAGGTCTAAAAGTGACCGAGGTGGTAAAATAAATTGCAGCAACTTGGCAA
AGCTTATCTAAGACTGACCGCTTAAAGTACAAAGAAGCTTCCAAAAGAGATAGAGATAGA
TATGAAAAAGAGCTAAAAACTCTGGAAGATTTCTCGGACAATCTCAAGAAACCCAAGAAA
TGTCTGTCGGCTTATATGATATTTACCAGACCTAAAATCGTATAAAAGAATCCAGATATG
GGGGCTCTTCAAGTCATGCAAGAAGTCGGCAAGCAATGGCAGGCTATGACGACTGACCAA
AAGAAATATTTCAAACAAAAAGCTGATAAAGACAAAGTGAGATACTTGAATGAGCAAAAG
GCTTACTATGATGAAGTCGAGAAAGTAGGGTTAGCAGTTGGCACCACAACTAACAAAGAA
GGCATGATTGTAGTTTCAAGCTAAAATAAAACTTATTAACCAAAATCTTTGTTCTGTCAG
AAGAATGTTCTAAAAGCATGCACGAATCCTAATGAAGAGATGCAGTCTTTGCTCTAAAAG
CGTAAGCTAAGTATCAACAATCAACAAACTAATAACCAGCTTCTTAGTGCCTTCAAAAGA
ATTAAGACTGAGGAAATGAATTAATACACAAATCTATAGCCATAGCAATAGATCACTAAC
TCCAGAAAAGGCATCATTTGCACCGAATCATATCAATAGTAATTTGATGGAAAACCTATA
AAGCCTTAACAATCAGTTGGCTTTTTTACTTAAGCTTTGAGAAATGCCTTGAGATAAAAA
TATCCCTTCTTAAATGATGCTTAAATTTGTAAAGCAGTAAGCTACAGGTGGAATTAATTG
AGTGATTAACAGAAATCTCCTTTTTAAAGTTTGGCTGATGTAGATAAAATCAGGTATGAA
AAGGAAGTTACGGACCTTAAAAATGGACAATTCAAGGGTAAATCTAAATAATTTGAAATC
AGCATTTTTTAAGAGCAACTCGAAGTAAAATAAGCTCTAGAAATCAATGACGACTTGTTG
ATATTCTTGCAAGTTAAGAAAGCTGTCAAACAATCTATTGAAAACTAAAATTATTCTCAA
GATACTCAAGGATAATAAGAGAGCACTTCAATTCATCAAGATTAAATGAATCACGGCTTT
TCTTATTAAAAGGGAGATTTGAAAAATTCTTAAATATTTTCTGAAAATGAGAGAAACAAT
GAAAATTCATAGTCCTAAAAGGATTCTCATCAAATAGTAAGTGACAGTAAATTGTTTGAA
AATAACAAGCTTAATATGTCAGCTGATTTTGATAATGATAAATCCCAGTTAGCCAAAGAT
ATTTTAAAAATGAACACCACTTCCTCAAACAACGAATTTTCAATGTAAAAAAACCTTTTC
TCAAGTAACCAGCTTCTTAACAGAAATTTAAACATAGGCTCTCTTAGTCAAACTATTAAG
AACCTAGCAAGCAACTTAGCTAACAACATCAGCCAAAACCCTAAGACAAATAACCTCCAT
TCTCAAAATATGAACAACTATGGCCTTGAAGGGTTCTAAGTTTCACATAACATTAAAGAC
TAATAAGAGCAGATAGCTCTAGATGGCGCACAATTTGCTACACTTCAAAGCTAAAACTTG
ATAATGGCTGATAACTAAAAATCAAATCTAATATAGTATGCTCCAAGATAAGCTCTAGGT
CAATAATACTAAATAGTAGACGAGAACGGCAAGAGCTATCTTATCCAAGCTCAACCTTAA
TAGTATAGCATTAATCCTTATGGCTAAATCTAATTTGGCCTCAACCCTTAAAATATCTAA
CAGACTCCATCAGGGTTGATAATTTCAGATAACTTGCTCTCATAAAACATAACAACAAAT
CCCCAATCTCTGTATATGAATCCTTTGTTGAATCAAGGCATACAACTAAATCCCTTCTAA
CAGTAAATAGAAATCATCGACATTAACGGCGTCCCAACTCAAGTTTTGACCACAGGCAAT
CAGATGCAGTACATATAGCAAGTCCCACAAGGCATTCAACAATCCTACATGCCTTAGCAA
AACATGATATTCTAATAATAGCTTCCTACTCAGCAATTAATGCAAAGTTCTTAACAACAG
TAACCAACTTAACAGCAAATGAACTAAATTGTAAATAATTAATAACAACAGCAAATCCAT
CAGACTTTAACAGATAAACCTGGGCAGGTCAGTAATAATAAACCTGTTCAAGGGCTATAT
TATGACAATAATCAGATGTAAAACCATATAAACCTTCAAAATCAATTGAATGCACAAGGC
TAATAATATATGTAATGA


>Contig4075.0.g7(protein)
MNQYKATTSNFMLYNPQDEEADSLIEEELKNEFIEEETITDKEFQRAMQKLKNRGLNAVP
PKKSASAYIIFGKEKREEIIKKNPGLKVTEVVKQIAATWQSLSKTDRLKYKEASKRDRDR
YEKELKTLEDFSDNLKKPKKCLSAYMIFTRPKIVQKNPDMGALQVMQEVGKQWQAMTTDQ
KKYFKQKADKDKVRYLNEQKAYYDEVEKVGLAVGTTTNKEGMIVVSSQNKTYQPKSLFCQ
KNVLKACTNPNEEMQSLLQKRKLSINNQQTNNQLLSAFKRIKTEEMNQYTNLQPQQQITN
SRKGIICTESYQQQFDGKPIKPQQSVGFFTQALRNALRQKYPFLNDAQICKAVSYRWNQL
SDQQKSPFQSLADVDKIRYEKEVTDLKNGQFKGKSKQFEISIFQEQLEVKQALEINDDLL
IFLQVKKAVKQSIENQNYSQDTQGQQESTSIHQDQMNHGFSYQKGDLKNSQIFSENERNN
ENSQSQKDSHQIVSDSKLFENNKLNMSADFDNDKSQLAKDILKMNTTSSNNEFSMQKNLF
SSNQLLNRNLNIGSLSQTIKNLASNLANNISQNPKTNNLHSQNMNNYGLEGFQVSHNIKD
QQEQIALDGAQFATLQSQNLIMADNQKSNLIQYAPRQALGQQYQIVDENGKSYLIQAQPQ
QYSINPYGQIQFGLNPQNIQQTPSGLIISDNLLSQNITTNPQSLYMNPLLNQGIQLNPFQ
QQIEIIDINGVPTQVLTTGNQMQYIQQVPQGIQQSYMPQQNMIFQQQLPTQQLMQSSQQQ
QPTQQQMNQIVNNQQQQQIHQTLTDKPGQVSNNKPVQGLYYDNNQMQNHINLQNQLNAQG
QQYMQ