Identifiers and Description

Gene Model Identifier

Contig17884.0.g118

Standard Name

HMGB1c

Aliases

Contig17884_0_g118

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam09011 ) Domain of unknown function (DUF1898)
  • ( pfam08073 ) CHDNT (NUC034) domain
  • ( pfam06382 ) Protein of unknown function (DUF1074)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKL032C0.0000000000599805963605737IXR1 SGDID:S000001515, Chr XI
from 381858-380065, Genom...
T. thermophilaTTHERM_004465700.000000100009565553302hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17884.0.g118(coding)
ATGCGTCAACTTCAAAATCACAATTCAGCTGGATTGCCAAAATTGCAACAACAAAGCTGC
CTTAAATCCGGAAACCAATTTTCATCAAACTAAAATGAGGTACGAGACATACACGGGATG
CTTCTCAGAAGATAGAATTCAACCATGTCAGAAAGAAAGAGAGAAGTGAAGCATCATAGA
AAAGCTTCTTATTTCACAAAAGTTCAAAAAAAACAGGAAGGCCTTTTATCGGAAGACGAT
AATATCAGCAGCTTTAATGTTTACGGGGACGAACAAGCCATTATTTCATTCGATCCGTTA
CTAGATCCTCAACCAAACGAGTATATGCACTCTAGTATCATGACTGAAGAGAGACTCATC
CTCGATGATGATTACATGCTTGATATAACTCAAGACCTTCCCATTAGAAAACCTCAATCG
GCCTATGTGATATTTGGAAAAATGAAAAGAGACTTAATAATGCGGTAGAACCCTGGCATA
AAAGTTACTGAAGTCGTCAAACAGATCGCCAAGCTATGGCAGGCCCTTTCAAAAGAGGAA
AAATTGAGATATAAGGACAGAGCAAAGCAAGGTAAATTTGAATTTTATGATGTCTCATCT
TAAAATATTATAGATAAGGAAAGGTATATTTAGGAATTGAGAGAGCTCACAAAGAGCAAT
AAAAATCTCGAAAAACCAAAGAAACCCCTCACTCCCTACATGCTTTTTGTTAGAGAGACG
AGACCTAAAGTTGTTCGAGAAAACCCAAATATTGCATCCCTTGATATTATGAAGGAAGTT
GGAAGAATATGGTAGAACATTACCAAAGATGAGCTCCAATATTTCAAAATTAAATCTGAC
TCAGATATGGAGAGGTACAAGAAGGAGCACTAAAAGTTTATTTAGGATATAAATGATCTT
CGGGCTCTATCTACAAAGGAGAAGAACGATTTGAAATTACAAACTGGAGACAACCGATTG
TTGTCAGACAGGGTGCCTTAAATCAAACCCTAACAATGCGACGAAAATTAGTTATCAGGA
ATCAAACAGTTTAATGTTCAAGAGAAAAGAAGAAAGATAGATTAAGTGAACAATATGCAA
ACTCCAGAACCGCTAATTAAAGGAACGCCGTTGAAATAAGATAAAAATTACGCTCATTAT
GCACAGGATACTCCATCAACCAACAATGATGAACCTGTAAGCCCTTACATGCGAGCGAAA
CGTGAGGTATCCCGCCCAAAGAAGCCTCTCTCTGCTTATATTTACTTTAGTTAGGAGTTT
AGAGAAAAATTGAAGGAGCAACACCCAGAGTGGTCCTCTAACGAAATCATGAGGCATGTA
AGCAATAAATGGTAGCATATGGACAGACAATAAAAAGATCCCTACAATCAAATGGCTGCT
CTCGATAAGTCAAGATACGATAAACAGCTTTTAGAGTTCACATAAATGGCAGAAGCTCCT
GGAGAGCACATTTTTGACTTCAGAAAGCCAAGGAGATCATTTGATAATAGCGAGAGTCAG
AGTCACTCACATCACAATTTAAACATTTCTGATATGAAATGCTAAGAATATAAACCTAGA
AACTCTGCCACCAAAGATACAAATCCATCACAACACGGTGAGTATTTGAATGCTTACTAA
CACGATGAAAAGTTCCCTATACCTCAGAGAAGTCCAATGAGAGGTCAAGATGACTCGAAC
ATCCCTTTTACTCCCTTCAATAACGCTGCTACTGTTGGATCCTCAAATTATTACAACATG
GAACCACCTTCCTCAATTTAAAATTAAGCTTACTAAACACAAAATGCGGGATCAGGTATG
AATCAGGGTGCTCTAAATTATCAGCAACCTGGTTATATGAATTAGTCTCCGATGGTAAGA
CCTCTCTACCCTGACTTTAACATGTCGCAGAGCAACACGAAGTTCCTTTGTGAGGATGGG
CAGATGGATTTCCAAAATACGAACTACGACAGCTTCAACTAGCAGCTGCTTTTACCTAGC
TTCTATAACTTTGACGAACAAAGTTTCTTCAAAAATCTTGATTCTTTCACTCAGAGAGCT
TCTAGCAACTAGGTACAAAGTGAAAACTATTTGAATGAAAAGAAAGATATTTTTGACTCC
TACGGGATGCGAGATTAGCAAGGCTTTAACTGA


>Contig17884.0.g118(protein)
MRQLQNHNSAGLPKLQQQSCLKSGNQFSSNQNEVRDIHGMLLRRQNSTMSERKREVKHHR
KASYFTKVQKKQEGLLSEDDNISSFNVYGDEQAIISFDPLLDPQPNEYMHSSIMTEERLI
LDDDYMLDITQDLPIRKPQSAYVIFGKMKRDLIMRQNPGIKVTEVVKQIAKLWQALSKEE
KLRYKDRAKQGKFEFYDVSSQNIIDKERYIQELRELTKSNKNLEKPKKPLTPYMLFVRET
RPKVVRENPNIASLDIMKEVGRIWQNITKDELQYFKIKSDSDMERYKKEHQKFIQDINDL
RALSTKEKNDLKLQTGDNRLLSDRVPQIKPQQCDENQLSGIKQFNVQEKRRKIDQVNNMQ
TPEPLIKGTPLKQDKNYAHYAQDTPSTNNDEPVSPYMRAKREVSRPKKPLSAYIYFSQEF
REKLKEQHPEWSSNEIMRHVSNKWQHMDRQQKDPYNQMAALDKSRYDKQLLEFTQMAEAP
GEHIFDFRKPRRSFDNSESQSHSHHNLNISDMKCQEYKPRNSATKDTNPSQHGEYLNAYQ
HDEKFPIPQRSPMRGQDDSNIPFTPFNNAATVGSSNYYNMEPPSSIQNQAYQTQNAGSGM
NQGALNYQQPGYMNQSPMVRPLYPDFNMSQSNTKFLCEDGQMDFQNTNYDSFNQQLLLPS
FYNFDEQSFFKNLDSFTQRASSNQVQSENYLNEKKDIFDSYGMRDQQGFN