Identifiers and Description

Gene Model Identifier

Contig502.1.g89

Standard Name

HMGB1b

Aliases

Contig502_1_g89

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam09011 ) Domain of unknown function (DUF1898)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKL032C0.000000000000008995967261938872IXR1 SGDID:S000001515, Chr XI
from 381858-380065, Genom...
T. thermophilaTTHERM_002572300.00000030014504373857585Nonhistone chromosomal protein
LG-1, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig502.1.g89(coding)
ATGACAACACCAGCAAAAAACTCTAAAAAAGTAGAGATAAAAACTGAAGAAGAAGATCTC
GAGCTCCAACTCCTTGAAGTAGAAGACGAAGAAGAGGAAAAAGAGTTGGAAGAAATGCTC
GAAAAAGAAGTAGATAAGCAGACTATTACAGATAAAGAGTTCTACAAGGCCATGCAAAAA
CTGAAAGAAAGAGGAACAAACGCTGTTCCTCCAAAGAAATCAGCTTCAGCTTACATTATA
TTTGGAAAAGAAAAAAGAGCAGAAATACTGTCAAGGAACCCCACTGCCAAAGTCACTGAG
GTAGTCAAGGAAATTGCTCAGAGTTGGGGAATCCTCAGCAAGGAAGATAAGCAAAAATAT
AAAGACGCAGCCAAAAAAGATAAGGAAAGGTACGATAAGGAATTAAGATCACTAGAGTCT
TTCTCTGAGAAACTGAAGAAGCCCAAGAAATGCTTGTCAGCATATATGATTTTTGTCAAA
GAGACCAGGCCACTGATTGTTGATGAGCATCCAGAAATGGGAGCTCTCTAAGTAATGCAA
GAAGTTGGAAAGCAGTGGCAGGCTCTAACTGAAGAGCAAAAGAACTACTTCAAGGAAAAA
GCTGATAGAGACAAGCTCAGATATCTGAATGAACAGAGGGCTTTTTATGATGAAGTTGAA
AAGATTGGATAAAAGCATGGAACTGTAACAAACAAGGATGGTCAAGTAGCAGTTGCTGCC
TAACAGTAGCAAGTAGATTTGATGAACAAACCCAAGAATGGAGTTGCTGTGACTCTTAGA
CCAGGCCAAACTGGCAATGCTAAAATAGGAGATAATTAAAGTTCCCAACAATCTAATTTA
CAAAAGAGAAAGAACCTTGTCTCGCTTATTCCAAATGAGTCACCTTTAAAAAGACTCAAA
ACTGATGAAATGAAAAATGATCCTAACTCCACTAAGATAAGTATGCCTATCCATCCTATT
AATTCTGAAAATAAACCGAAAAAGCCTCTCTCCGCTTATATCTATTTCAGCTAAGAGTTT
AGAGAGATCATCAGAGCAAGGTACCCCACTATGACTGTTATTTAAGTAATGAAAGCAGTT
AGCTATAGATGGGGAAATCTAAGCAAAGAACAAAAGTACCCATTTGAACAGATGGCAGTT
GAGGACAAGCAACGATATGACAAGGAAATAAACGACTGCAAAAAAGGCACATTCTAGGGT
AGATCAGCAACTCCTTAAATCAGAATCCAGTAAAACAGTGAAGCTGTAAACACTGCTCTA
GAGATCACAGACGATCTTATCATTTACTTGCAAGTCGGAGTAAACAATGACAACGGTGAG
GCTTTCAAAGACCCACATGATGAAAACTAAGATGGTTAGTTTGAAGACTATGATGAGTAA
TATGAAGAAAATGAATTTGAATAACCAGATAACCCAACTAATTTCAATCAAACGAATGAC
TTGAGAGTGGTTATTGAAAACTTAGATGAGAATGCTATAAGAAACAGGAAAGATAGTCTC
ATTAATCCTTTAATCTAGAACATGAAATTTGATAATGAGGAGCATGTAGGAGACATTTAA
AACTAAATGCAGTAAATGTCTGGTGGTGTGATGCAATAATAAACTTAACAAGATATGAAT
GCCATGAATCAATATGGATAGTAGCTGTTACAAATGCCATCTCATTAGCAACATCTATAA
GCATGTCTTTCTCCCTTTGGCTTTAATGAAGGAACAAGGAATTTGATGCTACAGAATGAG
CTAGCTAAGAGAGAAAATGAGCGAAAAACAAGCATGAGTTTTGCTTATGGAAGTAACAGC
TTCTTCACTGCCTAATCTCCTGCAATGAGCTCTCTCATGCCTGGCAACATGATGCCTTTC
TAATTTATGACAGGCTTTGGTCTTAACGACGACAATGCAGCCTTAAATTATTACACTGGT
GGACCCTTCCAGCTACCACCTAGCAATAACTAGCTTTAAGCTCAGTAGAACACTTTCTAA
AATAACTTTGGCAGATTCAATCAGAACTAACAAATTAAGATCTAAAACTCGCCTTAACTT
GGGTCGATGGCACCTCCTAATAGCATGATGATGAACCCCAATAGTTTTATTGGTGGAGGT
CAGCCTACAACTGATTTTCATTCAAGTTTATCGCCTTTCCTAGGTCCCTAACACCCTTAA
TTTATGATGCCATAAGCTCCCTAGTAATAGCAATTTTAAGGAGGATTTAATCCTTAAATG
TTTAATTAAACTCCACAGTCAAATATGAGCACAACCCCAAATAGTTCAGCAAATGGATAA
TAGCAAAATTAAAACAATTAACAAAGCTTAATGAGATGA


>Contig502.1.g89(protein)
MTTPAKNSKKVEIKTEEEDLELQLLEVEDEEEEKELEEMLEKEVDKQTITDKEFYKAMQK
LKERGTNAVPPKKSASAYIIFGKEKRAEILSRNPTAKVTEVVKEIAQSWGILSKEDKQKY
KDAAKKDKERYDKELRSLESFSEKLKKPKKCLSAYMIFVKETRPLIVDEHPEMGALQVMQ
EVGKQWQALTEEQKNYFKEKADRDKLRYLNEQRAFYDEVEKIGQKHGTVTNKDGQVAVAA
QQQQVDLMNKPKNGVAVTLRPGQTGNAKIGDNQSSQQSNLQKRKNLVSLIPNESPLKRLK
TDEMKNDPNSTKISMPIHPINSENKPKKPLSAYIYFSQEFREIIRARYPTMTVIQVMKAV
SYRWGNLSKEQKYPFEQMAVEDKQRYDKEINDCKKGTFQGRSATPQIRIQQNSEAVNTAL
EITDDLIIYLQVGVNNDNGEAFKDPHDENQDGQFEDYDEQYEENEFEQPDNPTNFNQTND
LRVVIENLDENAIRNRKDSLINPLIQNMKFDNEEHVGDIQNQMQQMSGGVMQQQTQQDMN
AMNQYGQQLLQMPSHQQHLQACLSPFGFNEGTRNLMLQNELAKRENERKTSMSFAYGSNS
FFTAQSPAMSSLMPGNMMPFQFMTGFGLNDDNAALNYYTGGPFQLPPSNNQLQAQQNTFQ
NNFGRFNQNQQIKIQNSPQLGSMAPPNSMMMNPNSFIGGGQPTTDFHSSLSPFLGPQHPQ
FMMPQAPQQQQFQGGFNPQMFNQTPQSNMSTTPNSSANGQQQNQNNQQSLMR