Identifiers and Description

Gene Model Identifier

Contig22304.0.g107

Standard Name

HMGB1a

Aliases

Contig22304_0_g107

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002160400.00000000009001903211590313HMG box family protein
SGDYBR089C-A 147.0

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22304.0.g107(coding)
ATGTCAGAGGAACAGGCACGTATGATGAGAGACGCTTGCAGGCTTGCTGCAAGTTTCTTC
AGCGACCTTGCTCAGGTGTTTGAGGGAGGGTCACCAGTCTTGCACGGGAACAAAGGTGGC
TTCTCAGCAGGAGCAGACCTCGCTGTAGACGCTCTAGCTTCCCTTGGAGCCAAGCACAAA
ATTAAGGAAAAGGAAAAATCAGAAAAGAAATCTCAAAGTCAAAGTCAATAAGCAGACAAG
GAGCACCAGAACCATGGCCATGATGTCACTAAGGCATCTCAAGCCACAAACTCTAAATCT
TCAAAGAGCGGTAAGGATGAGGGAAAGGACAAAAAGAAGAAGAAGACCAAGGAAGAGAGA
AAAGATGGCACTGAGGGCTTAAAGAGACCACTCTCAGCCTACATGCTCTTCAACAATTTT
AGAAGACCAACTTTGAAGAAGGAGCATCCAGCACTTACTCTACCAGAGGTATCAAAGATG
ATTGGTGAGGAATGGAACAAGTTGGCAGACAACCAAAAAAGAGTCTGGCTTGAAAAATCT
AGAGAAGAGAAACTTGGATTCGACTTGAAGGTCCTCAGTTTGAGGAATGATAACTAGAAC
GCCAAGCCAGTCACCAAAGAAGCAACTAAAGAAGTACAAAACGGACAAACCGCCTCTTCA
TCAGTGACTAACTCATCTGCTCAAGCAGCTGAAAAATCAAAGAAGCCAATTTTGAGAAAA
AGCAGCAGCAGTTTGTCGTCTATCTCAGACGACGATGATGAGAGCAACATCGTAGACACT
CATTCCAAGAAGAAGGCAATCAACAGCGACTCAGATTGA


>Contig22304.0.g107(protein)
MSEEQARMMRDACRLAASFFSDLAQVFEGGSPVLHGNKGGFSAGADLAVDALASLGAKHK
IKEKEKSEKKSQSQSQQADKEHQNHGHDVTKASQATNSKSSKSGKDEGKDKKKKKTKEER
KDGTEGLKRPLSAYMLFNNFRRPTLKKEHPALTLPEVSKMIGEEWNKLADNQKRVWLEKS
REEKLGFDLKVLSLRNDNQNAKPVTKEATKEVQNGQTASSSVTNSSAQAAEKSKKPILRK
SSSSLSSISDDDDESNIVDTHSKKKAINSDSD