Identifiers and Description

Gene Model Identifier

Contig6860.0.g24

Standard Name

HMG9

Aliases

Contig6860_0_g24

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR052C0.000004000864880866421NHP6A SGDID:S000006256, Chr XV
I from 665974-665693, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6860.0.g24(coding)
ATGGAAAAGCAAGGCAAGAAGTAAGCTAAAACAACCACCACAACAGCTGTCCAAAAGGCT
GGCAAGAGCTCAGACAGAAAGCCAAGATCAGTCTCCAAGGCTGATGGCAAGAAGGGAAGC
AACGCTAGCAAGAGCAAGTCAGCTGTCAGAGGGTCTTCCAGTGCCAAGAAAGACGGCAAG
GGCACATCTGGCAAGAGCAGAGATCGCAGATCATCATCCAAGAACAAGAAGACTTCTTCA
GACACTGGCAAGCAATCCAAACTTCAAGACAAGAAGAAGGGCAAGAAGGATGAAGCCAAG
GAAGAGGAAGATGATGAGCCTGTCATGAAGCCAACAAGAGCTATCTCTGGCTACATTTTC
TTCTCGAATGAGATGGTGCCAAAGATAAAAGTTGACGAGGGCATCCCTCACAAGCAAGCT
ATGAGCAGAGCTGGAGAAATCTGGAAAGGCTACTCTGATGAGGAGAAGAAGAAGTACGAA
AAAATGCATGAAAAAGATCAAGAGAGGTATGAGAAGCAGCTCAAGGACTTGAAGGACAAG
GGATACTTCATGATGAGTGACGGCACCAAGAGCACAGATCACGAAGTCCCCAACAAGAAG
AAGAGAGCCAAGAGCACCGACAAGAAGAGAGGCAAGTCATCCACTGGCAAGAGAAAGTCA
GTTATGGACAAGAGCACTGACAAGGGCAAGAAAGGCAAGGGCATTGCTGCTTCAGGCAAG
AAGAGCACCAAGAAGTCAGATGACGAGGACCTTGACATCGAGAGTGGCAGCGGAAACGAT
GACGACTCAGTTGAGAACTCTGCTTGA


>Contig6860.0.g24(protein)
MEKQGKKQAKTTTTTAVQKAGKSSDRKPRSVSKADGKKGSNASKSKSAVRGSSSAKKDGK
GTSGKSRDRRSSSKNKKTSSDTGKQSKLQDKKKGKKDEAKEEEDDEPVMKPTRAISGYIF
FSNEMVPKIKVDEGIPHKQAMSRAGEIWKGYSDEEKKKYEKMHEKDQERYEKQLKDLKDK
GYFMMSDGTKSTDHEVPNKKKRAKSTDKKRGKSSTGKRKSVMDKSTDKGKKGKGIAASGK
KSTKKSDDEDLDIESGSGNDDDSVENSA