Identifiers and Description

Gene Model Identifier

Contig1975.0.g17

Standard Name

HMG7

Aliases

Contig1975_0_g17

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1975.0.g17(coding)
ATGATGCAATAATATGCTCAATAATTAGGCATGCCACAGCAGCAATAATTGATAAGCCCT
ACAAGGACCATGCTGTTACCTCCAATTTAGTAATAAATGCCGCCTTTGCAACAGCACCCA
ATGATGTTCCAACAACCAAATTATCAGCCAATGTAGTAACAATAGTAGTACTAATAAGTT
TATTAATAAGTCAGACCTCAACCATAACAGCAAGAAGTTCCCATTGGAGAGTTTATTGGC
TCTTTTTTGAAAGTCAATGCACCCAAGCTATCTAGATTCCTATATGACTTGTATAGCATC
ACTGATGACTACATTCAAAATCAAAAGTATTAATAAGAGATGATTCAACAACAATAACAT
CAACTAATTTATCCACCGTAACAGTAGTAGCAACAGTTTCTTCATCAAACTGATGTAATG
CAGAATTATCAACCAGTAGGAGTTCCACTTTAAAGATAGTAAGCCCACAATATATAGTAA
AATGTGGCAACATCTCCACAACACCAAATAATTCAAAATATGCCAATAGGTTAACAACAG
CAATACACAAATTAATCTGCTGGTAACACTTTAAATGGAAGTGTTTCTAACACATACGAT
GCCTAAAATCAAGATCTTGTCTAGAATATAATCGAATAACAGAACCCTCACTAAGATCAA
AAGATTACTCTTTAAAAGCAAGCTTAGAACAAAACTCTAACTAAAGTGAAAACTTAAGTT
CCAATTGAATCAGTCAGAAATAAGGAAATCGCTTAAATGCCAAATACACCTCATTACACT
TCTGATAACGCTTAAAACCAGTAGTCGATAAAGCATGAATAAGTGTAAGAGGACTAAAAG
ATGCCTGCTCAATAATTAATGAACCAAGCTTTGAAAAGAAAGAAACCAAACTCAAAAGAT
AAGCCTTAACATGAAAAAAAGCCAATGACTCCCTATTAATTGTTCTAATTATAAATCTCA
AATAAACTCAGGAAGGAGCATGATGATGCAAAGAATAACGATTTAGCTAAAATTTCTGGT
GATTTATGGGGTCAACTATCGTACTAGGAGAAGGATATGTGGAGAAGGGAAGCACTTAAA
AGAGCAGAGGCATGTGGTTAAAATCTTGATTATGAATATCTCAAGACAGTCAGTGATCCA
AGCAAGAAGAAAAAGAAAATAATCGTGATGAATGGAGGATTAGGCCCAACTGGAGGCAAT
CATATTTAACAAGAAAATCCTGAAGCTTAAGAAAATTAACAAATAAAATAAGTTTAATCT
GACGAAGAGAATAATAACGATTGA


>Contig1975.0.g17(protein)
MMQQYAQQLGMPQQQQLISPTRTMLLPPIQQQMPPLQQHPMMFQQPNYQPMQQQQQYQQV
YQQVRPQPQQQEVPIGEFIGSFLKVNAPKLSRFLYDLYSITDDYIQNQKYQQEMIQQQQH
QLIYPPQQQQQQFLHQTDVMQNYQPVGVPLQRQQAHNIQQNVATSPQHQIIQNMPIGQQQ
QYTNQSAGNTLNGSVSNTYDAQNQDLVQNIIEQQNPHQDQKITLQKQAQNKTLTKVKTQV
PIESVRNKEIAQMPNTPHYTSDNAQNQQSIKHEQVQEDQKMPAQQLMNQALKRKKPNSKD
KPQHEKKPMTPYQLFQLQISNKLRKEHDDAKNNDLAKISGDLWGQLSYQEKDMWRREALK
RAEACGQNLDYEYLKTVSDPSKKKKKIIVMNGGLGPTGGNHIQQENPEAQENQQIKQVQS
DEENNND