Identifiers and Description

Gene Model Identifier

Contig14791.0.g1

Standard Name

HMG6

Aliases

Contig14791_0_g1

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam09011 ) Domain of unknown function (DUF1898)
  • ( pfam06244 ) Protein of unknown function (DUF1014)
  • ( pfam01166 ) TSC-22/dip/bun family

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14791.0.g1(coding)
ATGATAAAATCTAAGAGCTATTTCACCTACCATCCTTAAGCAGTTCACTTCACGAAAGCA
GGATGTAACAGACAAACTTCTGATTTCATTAATGACTTTGCATAATGCCAATCCATGCTA
GGGGAATCTCATCACTCTTCCTACAGAATGCCTAGCAAGTCTTCTATGATGTATGAATAA
ACTTAACCTGCTGTGAGTAATGAAGTTCAAACCAGAAACAGTGGCTTTGATCCAAACTTA
TTCAGCAGCTACAAGACTTCTTTCAAATAGAGTTAAGAGAAGATTGATTCTTTTACAGAG
TTAAAATAGGTCCCTCAACACATTCTTGATAACTTGACTTAGTTTGAGAAAGAAATTTTG
GAAAGTTTGTTCTTCAAACTCAAGTCCCTCTCTTTACCAAAACAACCTTAGTCTGCTTTC
ATTTTGTACATGAGAAGTTTTTATTAGAAAAAGAAATTAGAAAAGCCATTTTTAGACCAG
AAGAAGATTGAACTTGAAGCTAAGTTGCTTTGGAGAAAGGAGTGTGAAGAGACTAAACTT
CTTTTTGAGCAAAAGTCAGATGAAGCTCTAAAATTCTATGAGAAAGAGTTTCAAGAATAT
TCTGACAGCTGTGAGTAGATTAGATCTGAGATTGATGAGATTATCGAGAGAGCAGATATT
TCAAGGATTGTCAGAAAAAAGATTTCACCTTACAGAATTTTCAAGAAAGAACTAGCTCCA
AATATAAAACTTGAGTTTCCTAACATGAGAAGCTAAGAACGTTAAATGATCGTGAAAGAT
AGATGGAGAAAGCTTCCAGACAGTGATAAACTCATCTTTGTGATTAAAGCTAGAATTGAG
GAAGAGAGGCATCACTACAAGAGTCTTCAGGCTTTTCGTCAGCAGAGAATTGATTTCTCA
AAGTCTGTTGTGAGAAGAGATACTCAAGAGAGTTACCATGAAGATTAAGCAAAGGAAGTT
CTTGTCCAAAGTTCAGTGAACTCTTTAGCTTCATCAATTCATGTTAGTGCAGATCTACTC
AATCAGAAATTATTGAGTAAAGAGAATGGCAAGAGCAGCACAACTCCATCTCAAGGATCT
ATGATTATTGAGTATAGTTCTTCAACCAAAAGCATTGGAGATGCTGATCCAGCAGATATT
GCAATTGTAGATCTCACAGAAAAGGTAAACACCCTTGAGTTAAGTAAAGAAAACTTGCTG
ATCTTTACAAATCAGTCACCTTCTTTGATTCAGAAATTTCAACATTCTCACCAGAAATCA
GCTGAATGTCTTGTGCCCTAACTTGAGACTTTACTTGTTGAGCCCAAGAATAAAGATGAG
CAGACTCTTCACTATCAGTAATCTGTGATCAAGAATAATGTCTTTGACTATGATGAGAGT
AGAAGATTCATGGACTCTACTTTGAGAATGAGTGGCATCAATGACAATGATTGA


>Contig14791.0.g1(protein)
MIKSKSYFTYHPQAVHFTKAGCNRQTSDFINDFAQCQSMLGESHHSSYRMPSKSSMMYEQ
TQPAVSNEVQTRNSGFDPNLFSSYKTSFKQSQEKIDSFTELKQVPQHILDNLTQFEKEIL
ESLFFKLKSLSLPKQPQSAFILYMRSFYQKKKLEKPFLDQKKIELEAKLLWRKECEETKL
LFEQKSDEALKFYEKEFQEYSDSCEQIRSEIDEIIERADISRIVRKKISPYRIFKKELAP
NIKLEFPNMRSQERQMIVKDRWRKLPDSDKLIFVIKARIEEERHHYKSLQAFRQQRIDFS
KSVVRRDTQESYHEDQAKEVLVQSSVNSLASSIHVSADLLNQKLLSKENGKSSTTPSQGS
MIIEYSSSTKSIGDADPADIAIVDLTEKVNTLELSKENLLIFTNQSPSLIQKFQHSHQKS
AECLVPQLETLLVEPKNKDEQTLHYQQSVIKNNVFDYDESRRFMDSTLRMSGINDND