Identifiers and Description

Gene Model Identifier

Contig16453.0.g38

Standard Name

HMG5L

Aliases

Contig16453_0_g38

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam09011 ) Domain of unknown function (DUF1898)
  • ( pfam01352 ) KRAB box
  • ( pfam12115 ) Salivary protein of 15kDa inhibits CD4+ T cell activation
  • ( pfam01935 ) Domain of unknown function DUF87

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007847100.00000030014504373857585HMG box family protein
SGDYBR089C-A 157.8

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16453.0.g38(coding)
ATGAAGCTAATCGGTAAAGAATGGAATGCTTTAGCACCAGATTAAAAACACATTTATGAG
GAAAAAGCTAAAATAGATAGAGAACGGTATCTATCAGAACTGCAATCTTGCAGTGGCTAG
AATATGAATGAGATGAGACAGGCTTCTAATATTGGGAATGACAGAAACTACAATGGAAAA
AATAACAATGAATAAGGTTCAGGAGTAGGGGAGAGTGGAGTAGTTAAGAAAACTAGAAGA
AGAAGGTTGAAAGAGAAAGGTGTACCTAAGAAAGTACTATCTCCCTATGTAATCTTTGTC
AAAGAGGAGAGACCCAAGATGATGATGGACAAGAACACCGTAAACTTCAAAGAAATAATG
AGTCTGTTAGGTTAAAGATGGAAGGAAATGTCAGAGGATGAAAAATTACCCTATCGCTAA
AAGTCAGAAGAAGATCGAAGCCGCCACTCTGATGAGTCTAAAAAGTACCTTGAAAAGAAG
CACAATGAAATGCACTCCAAAGAAGTAAGAAGAGGTAAAAATGGATAGCCAAAGAAGCCA
AGAACAGCTTACTAGATATTTGCACATGTGATCCGCAAAAAATTAAAAATTAAAAAACCA
CATGCAAACGATAGTGACATCTCAAAAGCTGTCACAATTGAATGGGCAAAGTTAAGTGGG
GACTAAAAGCGATTTTATCATGAAGAGGCTAAATTAGACAAGGAAAAATATGAAAAAGCT
ATAGAAGAATGGAAAAAGAGCCCCTAGAACGCCAAAAACAGGCAGATGATCAAATTGGAT
GAGAAAAGAAAACAGAGCATTATCAGTTTCATAAGTCATGGAATGGACTTTTACTCAGCT
ACGATGTTCAATCCACCTGCTAGTGAAGAAAATAAAGTTGAGAATGAAGTTGTGAAGAGT
GAAGAAGACAGCGATGAAGACGATTTTGATGTTGAAGAGGAGCTTTAAAAGTTTATAGAT
GGAGAAGACGAAGATATGGATGAAGACTTGGAAGATCCTTGTGAAGAAGAGAATAAATCA
AAAGATTAATAAAAATGA


>Contig16453.0.g38(protein)
MKLIGKEWNALAPDQKHIYEEKAKIDRERYLSELQSCSGQNMNEMRQASNIGNDRNYNGK
NNNEQGSGVGESGVVKKTRRRRLKEKGVPKKVLSPYVIFVKEERPKMMMDKNTVNFKEIM
SLLGQRWKEMSEDEKLPYRQKSEEDRSRHSDESKKYLEKKHNEMHSKEVRRGKNGQPKKP
RTAYQIFAHVIRKKLKIKKPHANDSDISKAVTIEWAKLSGDQKRFYHEEAKLDKEKYEKA
IEEWKKSPQNAKNRQMIKLDEKRKQSIISFISHGMDFYSATMFNPPASEENKVENEVVKS
EEDSDEDDFDVEEELQKFIDGEDEDMDEDLEDPCEEENKSKDQQK