Identifiers and Description

Gene Model Identifier

Contig926.0.g40

Standard Name

HMG5

Aliases

Contig926_0_g40

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam09011 ) Domain of unknown function (DUF1898)
  • ( pfam01124 ) MAPEG family
  • ( pfam01243 ) Pyridoxamine 5'-phosphate oxidase
  • ( pfam09606 ) ARC105 or Med15 subunit of Mediator complex non-fungal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003020500.000000000000001999258566166494hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig926.0.g40(coding)
ATGCTCTATCAATAAAATATTCAACAACCCCAGATGTTCTACCCAGCTCCTACCTAACCC
TAATTTATGAGCACAAATTTTTAACAGTAAATGCAAAATATGATACAAACTGGAGGATAT
TTCAATCAACCTTAAAATTATCCTCAAATATATAACTAATCTGAGAGCTTATAAGACCAA
TTTTATAATGAATAGACCTAATAACCTGAAATCAAAGATCCTGAATAAATATAGAAACTT
AACTTAGAAAGAGAGTAAATGAAGATGAAGAACTTCTTTATGCAAAATGTTGTTCAGCAT
GCCTTCGATGAAAATGGGTCTTTCTATAGCAATGCATAGAGATAGAGCATGCAGCAAATA
AATCAAAATTAACAGCCTTAATAAAACGTTTTAACTAAGAACTAGAGTCTTTAACCTTAA
TAAGCTGAGCCACAACCCTCTATGTCCAATATGCAAATATTCGAATAATACGGATAAATT
AAGTACTTACCAAATAGGAAGCCAGATAACAGTAATATTAAAAGGAGATAACGCTCGCAC
AAATCAACTCAGCCCAAATTATTTACAAAGCCTCCAGGAACGAAATACAATTCTTATCTA
TGTTTCTGCATGTACTACAGGACAGAGCTGAAAAAACTTGAGCCTAAAATGGCAAGTAGG
GATGTCTCAAGAATAATTGGTGAAAAGTGGAGGATGCTTTCAAAAGAGGAATAACAATAA
TGGAAAGAAGAGGCTATCAAAATGAATATTCGTGAAGCAGAGCAATACCAAAAAGAACAA
ATGAACTTACATTTAGCTACAGCAGCAAACCTTGAGTCAGAACTTGATGAAGAAAGTTCA
ACATTGAAATTAAAGAAGCAAGAGATGTTAAAATGCTCCTAAAACACCCGCACTGAGGAG
GATTCAGATTTAGATATAAACAATAATAATCATGGACAAGAAAATCTAGAAGGAGGAATT
CCACTCGAAAACAATTTCTTTGGGAAGGAGTCTGTTACGAATCCTGTTGAAGCTCAAAAT
GCTCCGTACATGACTTTATTTAGAAATTCTAATAGAGATTTGATTGAATTTTAAGAGAAG
CTTTGCTCTCGCCAATATGGACTTGTACTTGGAGTTGCAGCTTTATTGGGACTATAAAAT
TATACCATTGCGTTCGTGACAGTTGCTCCAGTCAGATCAAGAGCCTTTAACAAAGAATTT
ATGTCTGAATTTGAAACCCAAGTTAAATTAGATATGGGAACTTTAGCCACTGTTCCAGGT
TAGGGATACCCAGATATGGGAGCAGGTCCATTTTCTAAAAAATTACCCTACAAAGATTGG
TTTTAATTCAATTGTGCACAACGCATACACGCCAACTCACTTGAGCAATTATCTTGGGCT
TTACCAGCACTCCTTGTAAATGGCTTATTTTTCCAAAATTTTCAGCATCAATGGGCTTAG
TAGTACTATTAGGTCGTGAGCTTTACAGATATGGCTACATGAGGCATCGGGTTGATGGCT
TTGAGATATAACATGGGTGGATTTATTAAAAGAAGAAAGTTAGTATAGAGATGGACTATG
AAACCAATCGATAGAAAAATACAAGAAGTTATCAAAGAACAATAAAAGAGGATGAATGCA
TGA


>Contig926.0.g40(protein)
MLYQQNIQQPQMFYPAPTQPQFMSTNFQQQMQNMIQTGGYFNQPQNYPQIYNQSESLQDQ
FYNEQTQQPEIKDPEQIQKLNLEREQMKMKNFFMQNVVQHAFDENGSFYSNAQRQSMQQI
NQNQQPQQNVLTKNQSLQPQQAEPQPSMSNMQIFEQYGQIKYLPNRKPDNSNIKRRQRSH
KSTQPKLFTKPPGTKYNSYLCFCMYYRTELKKLEPKMASRDVSRIIGEKWRMLSKEEQQQ
WKEEAIKMNIREAEQYQKEQMNLHLATAANLESELDEESSTLKLKKQEMLKCSQNTRTEE
DSDLDINNNNHGQENLEGGIPLENNFFGKESVTNPVEAQNAPYMTLFRNSNRDLIEFQEK
LCSRQYGLVLGVAALLGLQNYTIAFVTVAPVRSRAFNKEFMSEFETQVKLDMGTLATVPG
QGYPDMGAGPFSKKLPYKDWFQFNCAQRIHANSLEQLSWALPALLVNGLFFQNFQHQWAQ
QYYQVVSFTDMATXGIGLMALRYNMGGFIKRRKLVQRWTMKPIDRKIQEVIKEQQKRMNA