Identifiers and Description

Gene Model Identifier

Contig16162.0.g58

Standard Name

HMG20

Aliases

Contig16162_0_g58

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam09011 ) Domain of unknown function (DUF1898)
  • ( pfam08954 ) Domain of unknown function (DUF1900)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR052C0.000030009396760408108NHP6A SGDID:S000006256, Chr XV
I from 665974-665693, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16162.0.g58(coding)
ATGATGCCTTAACAATTCTCGCCATTATAAAGCAAAACATCCTAGACCTATGATGATGCA
TTTTAGGCAGATTTCGTAAAGCATTAAATCAATAACAACCCTGGCTTTGTGTTTGAAACT
TTAAAACAATCCAACAACCCACAACTATTTCAATGTTACCAGAGTATCTTTAACTAGTAG
AGAGATCTTTCAAAGATTGTAAAACAAGAGGAAATGTGTCCAGAAATCTCAAAATAAAAG
AATTAACTACTGAAAAAGAATAGTATTATTCTCAACCCAAAGGTGTAAAATGTACAACCT
ACAAATCTATTAAAACAAGAAGCCTAGTAAAATTAAAGCAACAACATTTACGTTTCGCAA
ATAAAAAAACCAAAAAATAAGTTCATTATGTTCAAGTAGGACATATTGCCTTCAGTAGTA
GCTTAGTACCCAAATATTACTCATATTCAGCATTGGCAGAAAGTTTCAGAATAATGGAAA
GTTCTGGCTCCTGAAAGGATGGCTTATTATGAAGAATTAGCTCAGTAAGACAACACCAGG
TATCGCAGTGAAGTTTAGGAAGAACGAGATAGAGTCATGAAGGAACAACCAGGAATTAAA
TTTCTGACTAAAGATCAAGCTGCTCAGATGAAGAAGAAAATTCCAGATAGAAATGTGAAC
AGAAATTCTATGGTAAAAATCAAAACTTAGCAAAAGCAAGAGAAAGCAAATTCTGGAGTA
CCATTTGGTCAAATTATTGAGAATTCATCCTTATAATCGAATCAATCAGCACCACTCATG
AAATAGGAATACTTTTAAGATGAGCCTAATCAGCATATTGAAGTTGCTCAATAACTTCAA
AAATCTACAAATTCATCCTAAAACAGTTAGTCTGTGCTTATAAAACGCAAAGCCAAAAAC
TCCTCAAATAGACCACGCCAAGTATGCGGCTACATTTTATACTATAATGAAAAATCAAAT
GAACTTAAAAAAACCACATAACTCGATAGTCTTGAAATACTTAATGTGATTTCTAGTGAA
TGGAAAGGATTAAGCGATGAGCACAAAGAATACTATAAAAACCTGGCTAATATCAGAAAT
GCAAATTATAAACGACTGTGCTAAGAACAAAGCGATAAAAATGTGATGGGAAACAAATAA
AGTTAGTGA


>Contig16162.0.g58(protein)
MMPQQFSPLQSKTSQTYDDAFQADFVKHQINNNPGFVFETLKQSNNPQLFQCYQSIFNQQ
RDLSKIVKQEEMCPEISKQKNQLLKKNSIILNPKVQNVQPTNLLKQEAQQNQSNNIYVSQ
IKKPKNKFIMFKQDILPSVVAQYPNITHIQHWQKVSEQWKVLAPERMAYYEELAQQDNTR
YRSEVQEERDRVMKEQPGIKFLTKDQAAQMKKKIPDRNVNRNSMVKIKTQQKQEKANSGV
PFGQIIENSSLQSNQSAPLMKQEYFQDEPNQHIEVAQQLQKSTNSSQNSQSVLIKRKAKN
SSNRPRQVCGYILYYNEKSNELKKTTQLDSLEILNVISSEWKGLSDEHKEYYKNLANIRN
ANYKRLCQEQSDKNVMGNKQSQ