Identifiers and Description

Gene Model Identifier

Contig16247.0.0.g96

Standard Name

HMG19

Aliases

Contig16247_0_0_g96

Description

Histone-like transcription factor (CBF/NF-Y) and archaeal histone

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam00808 ) Histone-like transcription factor (CBF/NF-Y) and archaeal histone
  • ( pfam09011 ) Domain of unknown function (DUF1898)
  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam10482 ) Tumour-suppressor protein CtIP N-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004465700.000009002574193719714hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16247.0.0.g96(coding)
ATGGCGGACAATTTAGACTTTCAAGAAATAGAAGATGATGAATTTCATCCTGATGAATAT
ATCGATGCTAATCAAAACTAGGACTAAAGTTTAATAACTAAGAGTGATACAGATCAGAAA
TTACATACAGAGGGTGTGCCTAAATCTTCAGGGGTTTACTAGCAGTAGAACTAGTAACTT
AAGAAACCAGCGACTGCATTTCAGCTGTACATCGGAGATTTGAAAAATGACTTGAGTTTC
AAGGAGTCATTAGGGGCCAATCATAAGGGATTCCTGCAGGAAGCATCTATGAGATGGAAT
GTGCTGGATGCATAAACAAAGAACAGTTTTAATGAGAGAGCTTAAAAGTTGAGGGAGTAG
CACAATGTATTGAAGGAATCGCTAGCTAGCAAGAAACAATAAAGGTAGAATTAAGACTTC
AATGAAGAAGAGGGAGATGAAGATTTATTAAATGGTGAAAATAACTATGATGATGATCCT
TAATCAATGAGAAGAAAGTTTATTCAATTACCTGCGAACAGAATCAGAAACTTGATATAG
AAAGATGAAGACTATAACTTGATCAGCAAATAATCTTTGCTTCTAATCACCAAAGCAACT
GAAATGTTTATCTCAGACTTGGCTGGAGTGTGTGATCTAAGATATACTTAGTGCTGCCAA
CAATATCGATAAGTTTCATTTCATCAAGGAGAGCAGATTACCTTCTTTGAAACCTAGAAA
GCAAGAAGAAAATGA


>Contig16247.0.0.g96(protein)
MADNLDFQEIEDDEFHPDEYIDANQNQDQSLITKSDTDQKLHTEGVPKSSGVYQQQNQQL
KKPATAFQLYIGDLKNDLSFKESLGANHKGFLQEASMRWNVLDAQTKNSFNERAQKLREQ
HNVLKESLASKKQQRQNQDFNEEEGDEDLLNGENNYDDDPQSMRRKFIQLPANRIRNLIQ
KDEDYNLISKQSLLLITKATEMFISDLAGVCDLRYTQCCQQYRQVSFHQGEQITFFETQK
ARRK