Identifiers and Description

Gene Model Identifier

Contig9685.0.g64

Standard Name

HMG17

Aliases

Contig9685_0_g64

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR089C-A 143.9

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9685.0.g64(coding)
ATGTTTCCAAATAACCAACTTTTAAACCAATCATTTTTGGGACTCGGTCAACAGAGCACT
CCAAATGCTGCTTCAGGTGCACTTTAAAACCCCCTATTTGGCTTTAGCAGCAGCATAATA
GCAAGCCACTCATAACAACAACAGCAGAACTAACTCTTACAAAATTAACAAAATGCTGCT
TTACTCAATCCATTAGCAGCTCTGCAAAGTCTAGGTAATCCAGCTGCTATGGGTATTGGT
GGTCTCAATCCATAGTAATTAATGATGATGTAACTCATGATGAATCCATCAGCAGCTATT
CTCTAGCAACAGCTTCAATTGTAACTTGCAGCTCAATAGGCAACTGGAGCTGGATTTGGT
GGCTTAGCTAATCAGATGTCAGGAATTAATGGAATGGGTATGATGCCTGGTTTGTTTGGT
ATGAATTAACAACAACAGCAATTAGGAACCTAGGCTAGTACATAGCAGTAAACCCAAACT
CAAGGAAAGGGCAAAGGAAAGAAAAATCAGGATGCATCTCAAAACTAACAACAACAACCA
TAAGAGGCAAAATCTAAAGAGAAGGCATAGAAGCCAAAGAAATGTTAAACACCTTATATA
GCTTTCGTAACTACCAGTATCAACTAAATTAAAGCCTAAAATCCGGGGATTGAATAGCCA
AAAGTCATGAAGAAAGCCTCAGAAATTTGGAACTCTTACACTGAAGAGTAAAAGTAGCCT
TTCGTTGATATGGCAAACAAGGACAAAATTAGACATCAAAATGAATCACTTATGATGTAG
CAACAAGCATTCATACAGAATCCTGGGTAAGTTAACGGTAAATAGAAGAGAGGGAAATAA
TCAAATCAAATGCAATAAGCAAACAATAACTCCCCATAAGGGTAGCAGACCTAAGGAAAA
GTAAAGAGAGAACGCAAAGGGGGTATCACTTCATTTATGGTGTTCAGTAAGTAGATGCGT
GAAAAGTACGTCATTGAAAACCCCAAGATGACTTAGAATGAAGTAATGTCCAGATCTGCT
TAAGACTGGAAAAATCTCTCTGAAGATCAAAAGAACTAGTATAAGCTTTTGGCTGATAAA
GTGAATGTAGATAGAAATAATGGAGGAGATGGTTAAAGTGTGATGTCCCAAGGATCTCAT
GATTTTGGAATGCTAACCAACAAATTGGCTTAGAAATATACTCAACAATTGCCTTAATCA
TTTGGAGACACTATAAATTCTGTGTCAACTGATGTGTCTACTGGCAGTCCAGTGCCTATG
AATAATGGTGGAGGGATGGACTACTTCAAAAATATGAATGGTGGGGACATGAATGGAGAT
CAGCAGCAATTATAGTAGCAGCTCAATGCTTAATATAACTAATTTAACCAATAGTAGCAG
ATGCAATTTGGATAACAATGA


>Contig9685.0.g64(protein)
MFPNNQLLNQSFLGLGQQSTPNAASGALQNPLFGFSSSIIASHSQQQQQNQLLQNQQNAA
LLNPLAALQSLGNPAAMGIGGLNPQQLMMMQLMMNPSAAILQQQLQLQLAAQQATGAGFG
GLANQMSGINGMGMMPGLFGMNQQQQQLGTQASTQQQTQTQGKGKGKKNQDASQNQQQQP
QEAKSKEKAQKPKKCQTPYIAFVTTSINQIKAQNPGIEQPKVMKKASEIWNSYTEEQKQP
FVDMANKDKIRHQNESLMMQQQAFIQNPGQVNGKQKRGKQSNQMQQANNNSPQGQQTQGK
VKRERKGGITSFMVFSKQMREKYVIENPKMTQNEVMSRSAQDWKNLSEDQKNQYKLLADK
VNVDRNNGGDGQSVMSQGSHDFGMLTNKLAQKYTQQLPQSFGDTINSVSTDVSTGSPVPM
NNGGGMDYFKNMNGGDMNGDQQQLQQQLNAQYNQFNQQQQMQFGQQ