Identifiers and Description

Gene Model Identifier

Contig12823.0.g19

Standard Name

HMG16

Aliases

Contig12823_0_g19

Description

Vesicle transport v-SNARE protein N-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam05008 ) Vesicle transport v-SNARE protein N-terminus
  • ( pfam03908 ) Sec20
  • ( pfam14362 ) Domain of unknown function (DUF4407)
  • ( pfam12352 ) Snare region anchored in the vesicle membrane C-terminus
  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam01496 ) V-type ATPase 116kDa subunit family
  • ( pfam14063 ) Protein of unknown function (DUF4254)
  • ( pfam03962 ) Mnd1 family
  • ( pfam12097 ) Protein of unknown function (DUF3573)
  • ( pfam04399 ) Glutaredoxin 2, C terminal domain
  • ( pfam06013 ) Proteins of 100 residues with WXG
  • ( pfam11871 ) Domain of unknown function (DUF3391)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12823.0.g19(coding)
ATGACTATAGATTTAGACGAGTTCAAGCAAACAAAGCGAGAGATCAAATAAATAAATCAT
GAAATCTCAGACTTGTTTGACTATGTTGAGGAGGAGAGAGCAGTTGACAAGAAATTGAAA
AGTATTGGAGAGTTGAAGTAAAATATCTCTCAAGCAGATAAATTGTTAGCTAAACTAGAG
TCACAATGGGAAATGCTAAATTCATAGAGCAAGGGTGCTTACAAAGCAAAGTTGACACAA
TTAAGATCAGAGTATGAGTAGGCTAGGAGTAAATATTTGAAGTTAGAGAGGTCAGCAAAT
AGCGAATAAAACAAGAACAAGATCATGAATTAAAAAGACGCTTATTAACAAAGGGAAGAT
GACATCAGAGAGAAACTGCTGAATGGAGTGGATGAATTAAACAACCAGGAAAAATAGCTA
GGGAACACTAAGAAATTGGGTATGGAAGCTGGAGAATTAATGAGAGCTGCAAATAAAGAC
TTAAGAGATTAAAGAGATATATTGGTCAACGTTCAAGATAAGAATGCCAACATTAGAGCT
GACTTGAGTGCAGGAGATAAAATCGTAGTGCAAATGACAAGGAGGGAGTATATCTATAGA
ATAGCTCTTAACATCACCATTATATTACTGCTTATGGCAATCATAGCAATTCTTATCAAA
AGACTTATCAAATGA


>Contig12823.0.g19(protein)
MTIDLDEFKQTKREIKQINHEISDLFDYVEEERAVDKKLKSIGELKQNISQADKLLAKLE
SQWEMLNSQSKGAYKAKLTQLRSEYEQARSKYLKLERSANSEQNKNKIMNQKDAYQQRED
DIREKLLNGVDELNNQEKQLGNTKKLGMEAGELMRAANKDLRDQRDILVNVQDKNANIRA
DLSAGDKIVVQMTRREYIYRIALNITIILLLMAIIAILIKRLIK