Identifiers and Description

Gene Model Identifier

Contig9572.0.g62

Standard Name

HMG15

Aliases

Contig9572_0_g62

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9572.0.g62(coding)
ATGAATCAGCAGCAGTTCTTAAATTAGGATGTCCTTGACAGTAGATCAGATGACTCTCAG
CAAAGTGTAGAGACAAATGCCTATAACAATGATCACTTGATCAATCAACTACTAAATCCT
TCAAAGAGTATATACAACAGAAATTACTCAAACAACAATGCCAATCTTGGCAACTAGCAA
AGCAACTTTAATGATTCAAGAATGCAACAAAACTTTAGCCAGGCTACCTTTGCAAATTAT
GAAGAGGAATCTAATGACTATGCTCAATTCTACAATTAGCAGCTTCAGCAAGTAATGAAT
GACTAAAACAGACATGACATGATGATTTAAGAAGATCCTAATTCTGACATTCAGCCTATT
TCAAGAAAACACTCATAACAAATATCAAGTCAAAAGGATATGCAAAATTATTAACAAAAT
AAAAACAATAAAGATGAAGGTCAGTCTCATCTAAATAACTGTATGGAAGAGGATGAAGTT
AACCCTAATTCTACTTCAGTAGTACTATTAAATTAAAAGAAATAAACTCCAATCGAGTCT
TTGATAGAATTTAGCAACTAGTACAACACTAAAACAGCAAGTAAGAAAGAACTATGTCAT
GAGCATAAATTAAGAAAGACCTGTTTTTGCACAGATTGCAGATTGTACATTTGTGATAGA
TGCTTGCCAATGTCTTAACATGCTGGACACAATACTCTTCACTTGTCAATGATGGCTTAT
AAAGTTCTTGAAGGGGTTAAAAAGGAACAAATGGCATTTGAAGAAAATTTGCAATAATTA
TAGAAAGTTAACCCACAGCTCTGGCAATCCCAAATTAGAAATTAAATGATCTAATTGTTT
GATGGTTTCCAAGAAAAGCTTAACATTCTAAAGCAGTAAGCTTTTCGTCAACTTAATGCA
GTAATTAAGTCTATGAATTTTTCAACTTTTGTTCAAGATATAGAGTCACTTCAGCAATCC
AGAGTAATTTTATAGAATTAATTTGAAGCTCTTACAAAAGCATTTGACGATAATCACTTC
TCACAAATAGCCAAAAGGTCAAATCATTATAGATCTTATATAGAATCATTAGAGATATTG
AACTTTGAAAGCTTAAACATGAGAAAATTAGTTGAGTAAAAGTCTGTTTATATGCAAAAA
ATATCTACAGATTTAAGGACTATGAAATTGAAGCTTCAAGAAGCCATAAAAATTATTAGC
AAGTCAAATCTTTAATAGAATGACTTAGAATTATTGCAAGATTAGAAAATTGAAATACCT
AAAACTTAAGTGATCACTCCTTTCTATCTTTATATGAAAGAAAATCAAAAGCAGGTTAAA
ACCCAATTCCCCAACTTTTGCAAACTTGAAATCGTTGGGTAATTGTAAAATCAATGGTAA
AAAGAAAATAAGCAAGTTCAATATTCATACGAGAGAAGAGCTCAAATTATGTGTCAAGAA
TAAAGCATGAAATTCATGCAACCAAGTCCAGTTCTGCCAGATGCTCCTACAGATGCCAAT
AAACCTTAAATTTTAAACATTTGTGGAGTGAAAAGAGTGTTTAATATCATCTATTGCAGT
AAGCTCTCAGATTTTAAGTCAGAAAACTGCAATCAAAATAATGTCAATAATGACACAGCT
AGGTCCGAAAACCCTTATATGAGCAATGAGTAAAAGCGAGAACAGAAGAGAAAATACAAA
AAGAGGCTGCTACTGAATCAAGCAATTAGACATCATAACTAGCAATTAATGATGAAAGAT
AGATAGTAAATTTCTACGGACCCATACAAATCTAGAGCTATGGAGTAAAAAGCAGATAGA
GAAAAAGATAGAAAATTCCCAACTGAAGACGTGCAGCATGTTAGACACATTGATAGACTC
TTAAAGCACTACAAGATTCCACCTCACAAATTACTAAGCATGATGAAAAATCAATAATAG
AAGGAAATTGCTGCTCGTTGA


>Contig9572.0.g62(protein)
MNQQQFLNQDVLDSRSDDSQQSVETNAYNNDHLINQLLNPSKSIYNRNYSNNNANLGNQQ
SNFNDSRMQQNFSQATFANYEEESNDYAQFYNQQLQQVMNDQNRHDMMIQEDPNSDIQPI
SRKHSQQISSQKDMQNYQQNKNNKDEGQSHLNNCMEEDEVNPNSTSVVLLNQKKQTPIES
LIEFSNQYNTKTASKKELCHEHKLRKTCFCTDCRLYICDRCLPMSQHAGHNTLHLSMMAY
KVLEGVKKEQMAFEENLQQLQKVNPQLWQSQIRNQMIQLFDGFQEKLNILKQQAFRQLNA
VIKSMNFSTFVQDIESLQQSRVILQNQFEALTKAFDDNHFSQIAKRSNHYRSYIESLEIL
NFESLNMRKLVEQKSVYMQKISTDLRTMKLKLQEAIKIISKSNLQQNDLELLQDQKIEIP
KTQVITPFYLYMKENQKQVKTQFPNFCKLEIVGQLQNQWQKENKQVQYSYERRAQIMCQE
QSMKFMQPSPVLPDAPTDANKPQILNICGVKRVFNIIYCSKLSDFKSENCNQNNVNNDTA
RSENPYMSNEQKREQKRKYKKRLLLNQAIRHHNQQLMMKDRQQISTDPYKSRAMEQKADR
EKDRKFPTEDVQHVRHIDRLLKHYKIPPHKLLSMMKNQQQKEIAAR