Identifiers and Description

Gene Model Identifier

Contig17213.0.g7

Standard Name

HMG14

Aliases

Contig17213_0_g7

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam09011 ) Domain of unknown function (DUF1898)
  • ( pfam05801 ) Lagovirus protein of unknown function (DUF840)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006914500.0000020007268868677913hypothetical protein
SGDYPR065W0.000009999254677478949ROX1 SGDID:S000006269, Chr XVI
from 679693-680799, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17213.0.g7(coding)
ATGCAAAACTAGTTAATGAATCATTAAAACTATGTACCACCTCAAATTGCACTTAATTAA
AATCAAGATCCTAGATAACAAGCAGCCCCCATATTTCATGTGAGCAGAGGAGCGGGTCAT
GAAAACGATTTAAAAGATTTCTTAGATTGGGATTAATAAATAAACTCTGACCGGCTTGTT
TTAAATGAAATTCAAAGAGAAAATATTCGAGATTACGAGTGCTGCATTTGCGATAACTTT
TTCCTCTAGCCAGTTGAGTGTTGTGAATGTGATGAGACCTTTTGTCTGGGATGCATTGAA
AATTACAAGCAAAGATGCATTCAGACAAAATAGCAGTAGCAATAGTAGGCACATGAAAAC
TAGAATAATGTTGAAACACCATGTCCTACATGCTAAAAAGAACTAGTGTTTAAGAAAGCT
CATAAAAACACAAGAATGAGATTGGCAAATGTACACATAAAATGCATATTCTCACCTGAC
TGTAACATAATTGAGACCTATGAGAAATTGCAAAAACATTAGCTTGACTGTAAATTTAAC
AAAATAAGATGCCCCAATTTTGAAAAATGCAAAGCTTACTTCAAGATTTAAGATAGACAG
GATCATTTGAGTCATTGCATTATGAATGAGTTAAAATGTGATTTATGCAATCATGAAGAT
GCCATTTTTGAAAGTGAAATTCAACTTAAAATTCACAAAGAATATGTCTGTGATTAAAAC
ATAGCTGAGAAGGTTTTATGCAGTTTTTGTAATGAACTTATGACTAAGGATATGTTCTTA
AAAACTCACCTTTTATGCAGCAAAGCAGTCGAGTAAATTTCTGACTTGAAAAATTAGCTT
AGCGTTATTGCTAGTTATACTTAACAAAATATGGTGAGAAATGGAATTCAAAATCAAGCA
GCAGTATCATAAACTGTAATAAGACAATTCAATGGAAGTAATCCTCATTAATAAAATTTT
AATCAATTTATGAATAATGGACAGAGACCTTAAAACAATTTAGGAGTGCAATAGCAAAGA
ATGTTTTCTCCATACATGCCACAAGGTTTCATGCCAGGCTAAGGAGCTGGTATGATGCAA
CCCAATCCCATGATGATGGGCATGGGAATGAACATGTAGCAATAACCCTAACTTCAAGGA
ATGGCTATGCTCCCTTAATAGATGTTAGCCTAGTAAAATCAACAGCCAAATCAAAATCAA
ATGGTACAAATGATGTTCTAGTAAATGACTCAGATGCCTGGCTTTTCGAATGAACTCAAT
AAATACATGAACTAACAAGGAAAATCAGGAAATCAAAATGCAGTTCAAGGTAATATTCAA
TCAACTAAAACTGGAAAGGGGAAAAAGCAAGTTCAAGCAGGCCCAATTTCAAACGTTAAG
AAGCCCAGAAATTCATTCATTTTCTTCAAAGAGTGCATTATGAGTCAACTCTTAGCAGAA
TGCCCAGGATAAGCTGTCTGTCAACTAATGACCCTGGCTGGATAGAAATGGGCTGGACTC
AGTGAAGACGAGAAAAAGAAGTACAGATAAATGGCAGAAGACGATAAACTCAGATATAAA
AATGAGATCGATCAGGAAAAGAAGGGAGTGCTCACTAATGCAGTTGGATCTATAGGTCAT
GGTATTGGAAATCAAACTAAAGTGAATAATATTGAGACCACAGCAACCACAGTAACTTAA
AAGAAGAAGAAAAGCGATGATAATACCCAGTCTACTAGACCAAAATACACTTCTTTCGTG
ATTTTCAACATGATGAAAGGTGCAGAACTCAAAAAGACTAATCCACAAATTCTCCCTCAA
GAAATAACTAAACTTTCAGGAGCAGAATGGAAGACTATGACAGACGATTAGAAAGATTAC
TATAAGAAGTTGGCAGATCAGAAAAACGCTGAATCATCCGCTTCTAAAGATGCTGTGATG
ACTGATATCCAGCCTTAGTAATAGCAATAATTCCAGTAAGTTACTCAAGTAGGTGGTGCC
AAAAGAATATAGCCATAGTAACCACCATAATAGATGATGATGAATCCTGCCATGATGATG
ATGCCACCATAAATGCAAATCCCAGGCTTATAGTTTATGATGCCCCAGATGCCTGTTGCT
GGTGGAGTGAAATTTGGACAAATAGCAAACCAGAATTGA


>Contig17213.0.g7(protein)
MQNQLMNHQNYVPPQIALNQNQDPRQQAAPIFHVSRGAGHENDLKDFLDWDQQINSDRLV
LNEIQRENIRDYECCICDNFFLQPVECCECDETFCLGCIENYKQRCIQTKQQQQQQAHEN
QNNVETPCPTCQKELVFKKAHKNTRMRLANVHIKCIFSPDCNIIETYEKLQKHQLDCKFN
KIRCPNFEKCKAYFKIQDRQDHLSHCIMNELKCDLCNHEDAIFESEIQLKIHKEYVCDQN
IAEKVLCSFCNELMTKDMFLKTHLLCSKAVEQISDLKNQLSVIASYTQQNMVRNGIQNQA
AVSQTVIRQFNGSNPHQQNFNQFMNNGQRPQNNLGVQQQRMFSPYMPQGFMPGQGAGMMQ
PNPMMMGMGMNMQQQPQLQGMAMLPQQMLAQQNQQPNQNQMVQMMFQQMTQMPGFSNELN
KYMNQQGKSGNQNAVQGNIQSTKTGKGKKQVQAGPISNVKKPRNSFIFFKECIMSQLLAE
CPGQAVCQLMTLAGQKWAGLSEDEKKKYRQMAEDDKLRYKNEIDQEKKGVLTNAVGSIGH
GIGNQTKVNNIETTATTVTQKKKKSDDNTQSTRPKYTSFVIFNMMKGAELKKTNPQILPQ
EITKLSGAEWKTMTDDQKDYYKKLADQKNAESSASKDAVMTDIQPQQQQQFQQVTQVGGA
KRIQPQQPPQQMMMNPAMMMMPPQMQIPGLQFMMPQMPVAGGVKFGQIANQN