Identifiers and Description

Gene Model Identifier

Contig17475.0.g71

Standard Name

HMG12

Aliases

Contig17475_0_g71

Description

Domain of unknown function (DUF1898)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteasome-mediated ubiquitin-dependent protein catabolic process (IEA) | GO:0043161
  • nucleotide-excision repair (IEA) | GO:0006289

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17475.0.g71(coding)
ATGTCTTCAACTATCACTTCAGAAATACAGCTTGACTCTATGATAAGATTATCTGGAGCA
GAGTAACCACTAGAACAACAAAAAATGATGGAATATCAACTCAGGACCTCTCAGTAAAGC
GACTAACACGAATAAAACATCTTAACTAACAATATGAGCAACTATCCAAACCAAGCTACT
GATTCTTTTCAAGAGTATACTCCACCAACTTAATTTGACCAGAAATTTTAAACTGATGAG
CTCATGATGGACATTAATGGAGTTCAAGTGCAAGAACAAATCAACACCTCAACATCTTTG
ATGCTTGATACTGGCTATTAGTTTGTTAATGACAATGATTTTGCTTCAGTTGATGACCAG
CTTCCTTCTTATATGAGAGGCTAAACTTCAACCAATCCAGAGATTTCAAACATGATTGTA
GAAAAGACTGAGCAAACTCACCTATCAACTCAAAGCCAAAACTTAACTCTGTAACAACTC
TAAGAGTTGATTCAAACAAATCCTCAACTACTTTAAGACCTCTTGATGAAGATGAATAAT
CCTAGTCTTACTCTAAATCCAACACCTTCAGCAAGACCTCCCTCACCATCTTACATATGT
ACTATTGAGCCAACTTCACGAATTTTTTATGATTAAGGCAGTTAATCTCACTTCCTGAAA
GATCAAAAGTCAACACAATCTCAGATGAGTTCACAAAAGTCTGATGAAAGTGAATCAGTA
TTTGAGCCTTCACATTTAAATTACAAAGCTAATATAGCAGATCAAGAGTAATTACCACTT
TTTCATGAGCAACTTAGTCATAGCAAACTGAACAAGTACGCTGACAAGTATGATTTGTGC
CAAGTCCATCCCAAAATGAAGAAAAATCACTTATGCACTGAAACTCAGGAACATCTTTGT
GATACTTGTATTATATCTGATGAGCATAAAGATCACACTACAGCTCCACTTTCTAAAATC
TCGCTTGAGATTCACAAATAATTTACAAGCCATTTTCACTAGTTTGAAAACTCAATGAAT
GCAATTGATAGAATCGACGCCAAAAACTGGAAGACTACTCTCAGATCAAACTACTTGTAA
CTCTTCGATGAGCTATTTAACTCACTTGATGTTATCAAGAACTAAAAGCTTCGAGATATT
AACGAGATTTTCACTCTCATTAATATTAAAGAAGTCAACCATGGTTTGAATGAGATGCAA
GTTTCGCATGATATTGCCAAGAAGTACACAAATCTTGTGAATCATATGTTTGATCAAAAT
TAATACAGTGCTATAACAAAGAGACAAGATCAGTTCACACTAGTAGGTTAAAGCATGAGC
TAACTCACTCACGATTGCAATGGTTTGCTTGATCTAGCTCAGTCAAAGAGAAGAAAACTT
GACATTATGCAGAATTAAATGCAAAGCTTAGTGTTAAAGATTAAGAATGAAACTGAGGAG
AAGCTTAAATCTATTGTAGATGAAGAGTTAATCATTTGCGATGTCTAAAAATTGAGAGAT
TTTACCAAGACTTAGGAGCAAGAGAGTCTTGAGTTGAAAAAAAGAAAAGAAGCTAGAAGT
GGATTCTATTACTTCTTGAAAGAATAGAAACCTATTATTCAGACTCTACAGCCTAATATG
AAGTATCTTGAAATTATTGCTTATCTTTAGACCAAATGGACTTCTTTGAACGAGGAGGCC
AAACTTACTTATGAGATGATGGCCAGTGATCATGAAAGGCAGCTAGATTAGGATTAAAAG
AAAAGACTTGGTTTAATCCCCAAAAACTTTGATTCTGACAAGGAGATGAAAACTCCAGTG
AAGGTTTCACTACAGCAAGATGGCTTTGATTAGAAATCTAAGAGATAAATCTAGAGCGCT
CCCAAAGAAAGTTCAGACGATAGCATTTTCTCTAATTCAGACAAGGATAACTCACCGCTC
TAAAGCAAACCAAGAAAGCAAAATCAGCCTACATCTATTCAAGAACAAGAAAAACCGAAG
TCTCTACTCGGCAAGAGAAAACTCAAAGAAAGAGAGGGATAGTAGCCAGACAACTTGGGA
ACTACTGAGGATGAGTAGACTTCAAGTCAAGAGAAGAAGAATGATCACCAATCTCAGAAG
CCAAGATAGCTTCATCAAGAGAGTGACAAGAAAACTGGAAAGTCTGCCCCAATCAAAAAA
TAACAAGCTACTCCTTAAAACCCTCCTACTAAGAAAACCCATTAAGTGACTGTGAAAAAT
TTGAATAAGTAACCAAGCAACAATATCAACAAGATTTGA


>Contig17475.0.g71(protein)
MSSTITSEIQLDSMIRLSGAEQPLEQQKMMEYQLRTSQQSDQHEQNILTNNMSNYPNQAT
DSFQEYTPPTQFDQKFQTDELMMDINGVQVQEQINTSTSLMLDTGYQFVNDNDFASVDDQ
LPSYMRGQTSTNPEISNMIVEKTEQTHLSTQSQNLTLQQLQELIQTNPQLLQDLLMKMNN
PSLTLNPTPSARPPSPSYICTIEPTSRIFYDQGSQSHFLKDQKSTQSQMSSQKSDESESV
FEPSHLNYKANIADQEQLPLFHEQLSHSKLNKYADKYDLCQVHPKMKKNHLCTETQEHLC
DTCIISDEHKDHTTAPLSKISLEIHKQFTSHFHQFENSMNAIDRIDAKNWKTTLRSNYLQ
LFDELFNSLDVIKNQKLRDINEIFTLINIKEVNHGLNEMQVSHDIAKKYTNLVNHMFDQN
QYSAITKRQDQFTLVGQSMSQLTHDCNGLLDLAQSKRRKLDIMQNQMQSLVLKIKNETEE
KLKSIVDEELIICDVQKLRDFTKTQEQESLELKKRKEARSGFYYFLKEQKPIIQTLQPNM
KYLEIIAYLQTKWTSLNEEAKLTYEMMASDHERQLDQDQKKRLGLIPKNFDSDKEMKTPV
KVSLQQDGFDQKSKRQIQSAPKESSDDSIFSNSDKDNSPLQSKPRKQNQPTSIQEQEKPK
SLLGKRKLKEREGQQPDNLGTTEDEQTSSQEKKNDHQSQKPRQLHQESDKKTGKSAPIKK
QQATPQNPPTKKTHQVTVKNLNKQPSNNINKI