Identifiers and Description

Gene Model Identifier

Contig18629.0.g90

Standard Name

HMG11

Aliases

Contig18629_0_g90

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR052C0.000050024383570459175NHP6A SGDID:S000006256, Chr XV
I from 665974-665693, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18629.0.g90(coding)
ATGACAGAGATAATCAACCAGAGAGTGTCAGATTACGAGTAAATTATCGCCAATTAGCAG
CAATAGCAGGAAGACCTTAGTGGCAATCAAATTGCTTCAGATAATCAGGAAAATAACTAA
GAAAACCAATTCAATAACAATGAGTCATTAAATCTGTAGTAGCAACGTGATTCTAACTTT
TAATAAGAAGAATTTCAGTAATAATTGCAAGTATCATAGGAACAGTTATCAACACATACT
GTTGAAGATCAAGATCAAAATGATGACAAATAGAACTAAGACAGCTAATTTGATAACGAG
CAGCATTTGAATATAAATTATAGGGAGTCTGACAAAGTGTCGGAAGAACTTACACCAAAC
TCACATGATCATTTGGATCAGCAATAATTTCATGATTAAAATTCCTAATAACAAAACGAC
CTCAATGAACAAAAGAGCCAAAAAAGTCAAAATGAAGTCCAAGAAAATTAAGAGTTTGAG
CCTATTTTCAATCAACAAGATTAAAAAGAATAGTATGAAGAGAGAATGTAAATCGATACA
ACAATGCTTGAATAAAGTTTCAGGTAAATATCTTTGGAGTAGCAAAGAGAAGAATATGCC
AAGTAAAACTATGGAGAGGAAGTAGATGAATTTGGTACACATTTGAATCCAGTAAGATAA
GAAGAGTTGGAAGAGTAGGCTGGCTTAAATAGGACATAATAGTTATAAAGATAAGCTTTG
CCATAACAACAGCAATAAATCTAAAAGCCAATATAAATGCAGCAGTTGCCAAATGGATTT
ATCTCTCAGAGACCACCTCAACCTGTACCAATGTAAAGTAATTCAATTCATAATCCAGAA
GAATAACAATATAATAGGGTATCGAGTCAAAAGCAAATTAACAGTGGGAGTGTAAATGCT
TTTCCAAACTTAAACTAGGCTATTGTGAATACTTCAGCTTTTTAATAAAAGTTATAGCTA
GAAAATGAATAGAATCAGAGGAAAATAAATGAAAACTATAAATTATTCTGTCAGTACCTA
TATTAAGAGATTATTAAAAAGTAGCCTCATTTAGTAACTGATGGAGATAAAGTAGCCATA
CTTATTGCAGCTGAATGGAAGAAACTACCATTAGATTAGAAACTCAATTATTCTCCACCT
CCTCCACAACTTCAATAAGCTTAATAGTAGATGCGCTAGACATTAGAATTAAATCAAACT
CAACCCGTTTTGCAAGGGCAATTTAGACCTTAATTGCCAATTCAATAAATGCATCACACT
TAATAATAGCAGTCTTATTAGCAATTGAATCCTATGTAAAATCAACAAGTATTGTTGCAG
TAAAATCCACAGCCTTATCATAGCACATAATCTTACTAAAGCAATAGTGGATTAGATATG
AAACTAAAGAAGTAACGAAGAACAAAGCATGAACTTGCTATGGCGGCTGAGAAGCCAAAA
AAGTGTATGACTCCCTATCTTTACTTTGTCAAGCTCAATCGTGCAAGGATCGGACAAGAA
AACCCAGGTAGATCATTCAAAGAAATGATGTAGCTTATTTCACAGCTATGGGCTCAGCTG
CCACCTCATGACAAAATTTAGTATGAATAAATGTCTAACTAAGATCGTATTCGTCACGAT
AATGAAATGCGGGAGTATCAGATTAACGTTATTTAAAAAGGTGTGAAGCCAATTAAGAAG
CAGCGAAGAACAAGAACCTCAAAAACTATTAACTTAATGCCAGGCCAAAAGCCAAAGGGT
AGCTATGATTCGGGGGCCTCACAGCAAAACATGGGAAATGTAATGAATCTTTACAATATG
ATTCAACAATAAAATTAAATAATCAACATGCTTTTGACTTAGCAAAATCAGTTTGTAGCA
GGCTAACAATAAAATACTCAGCAAAATATTGCTGTTGGAAATGCTTAATAAATGCAGCAA
CAGCAGTTAAATAATTAAGGACAGTAAATGTATGGTGGCTTATTTTGA


>Contig18629.0.g90(protein)
MTEIINQRVSDYEQIIANQQQQQEDLSGNQIASDNQENNQENQFNNNESLNLQQQRDSNF
QQEEFQQQLQVSQEQLSTHTVEDQDQNDDKQNQDSQFDNEQHLNINYRESDKVSEELTPN
SHDHLDQQQFHDQNSQQQNDLNEQKSQKSQNEVQENQEFEPIFNQQDQKEQYEERMQIDT
TMLEQSFRQISLEQQREEYAKQNYGEEVDEFGTHLNPVRQEELEEQAGLNRTQQLQRQAL
PQQQQQIQKPIQMQQLPNGFISQRPPQPVPMQSNSIHNPEEQQYNRVSSQKQINSGSVNA
FPNLNQAIVNTSAFQQKLQLENEQNQRKINENYKLFCQYLYQEIIKKQPHLVTDGDKVAI
LIAAEWKKLPLDQKLNYSPPPPQLQQAQQQMRQTLELNQTQPVLQGQFRPQLPIQQMHHT
QQQQSYQQLNPMQNQQVLLQQNPQPYHSTQSYQSNSGLDMKLKKQRRTKHELAMAAEKPK
KCMTPYLYFVKLNRARIGQENPGRSFKEMMQLISQLWAQLPPHDKIQYEQMSNQDRIRHD
NEMREYQINVIQKGVKPIKKQRRTRTSKTINLMPGQKPKGSYDSGASQQNMGNVMNLYNM
IQQQNQIINMLLTQQNQFVAGQQQNTQQNIAVGNAQQMQQQQLNNQGQQMYGGLF