Identifiers and Description

Gene Model Identifier

Contig22230.0.g52

Standard Name

HMG10

Aliases

Contig22230_0_g52

Description

HMG (high mobility group) box

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00505 ) HMG (high mobility group) box
  • ( pfam09011 ) Domain of unknown function (DUF1898)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR052C0.0000000029989608248573072NHP6A SGDID:S000006256, Chr XV
I from 665974-665693, Gen...
T. thermophilaTTHERM_002160400.000005000363240844623HMG box family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22230.0.g52(coding)
ATGGATTAGCGAATAGTGAATCCGTACGAAGGGGGTTTCTCAACCTAGTAACCGCAGCAG
CCAGGAACTGATTTGGGCTAACCGAGGCCTTTTACAAATTTTTAGTTTGTGTAAGGTCAA
AATAACTTCATCGACAGTCAGGATGAAGAGGAAAAAGGAGATGACTATGGCATGATGAAT
CCTCTCATACTTAGAGATTTTTAAGTTGGTGAAATTAAATCTCGGTCAAGCACTGGCTCC
TTGCTCAGTGAAAATAGCGAAAGCTCCATTGAGTCCCATTACTCGAAAGCTTCTAACTGG
ACAAAAGGCAGGAGCAGGCAGAGACTAAAAGTGCCTACTTCACTCAAAAATAACAACTAG
ATTTCAAAAGGGGTTAAAGAAAGAAAGAGCATTACTAAGTCATCATACCCAGAAAGATCT
GAAAGTGGATCATAACAAGATTTGCCAATTGTAAAATAAGATGTGCCAAACTAAATTTAA
GTCATGTATGATATCTCAGGGACCGTAATCCCACCTAAGAGACCGCTTTCTCCCTACATA
TTCTTTTCTCAAGAGCAAAGAAAGATTCTCAAGGGAACCCATCCAAATTGGAGCACAAAA
TAAATCATGAGAGTCGTTAGCACAAAATGGAAGCAAATGTCCGATGATCAAAAGAATGGC
TATAAAGTATTGTCAGACAGTGATCGCAGGAGATTTGATCAAGAAAAGAAGCTACAAAAG
GGCAGTAAGAGGCGAAAGAAGGGCAAAGTTTAAGAAGACTTAGGTGTTTTGCAAACAATT
GATGAACTAAAAGAAGAAGAAAATTTCTAAGAAGGCGTTCTTTTGCCAGAAAATTAGAAG
AAGCCAAGAAAGGAGAAAGAAGTTAAGCAAGTCAAAAGAAAAGTTTAAAGTTCTCATCAC
AATTTCATGATGTAATCTCAGAGTCAACAGCTACATCCTTAAAATGCCGCAATGAACAAT
ACATCTGTGAATCACATCAATATTGTAAATAACTTATTGGTTTGCAACAATGATGGTGTA
TAGCAGCTCCTACATCATTAACAGCAACCACCTCATTAATTTGACTAAAGTCGTGATGAG
TTTTAAATTTTCAAAAATATGCAGCAATCAGCTTAATAATATTCTTTCAATGACAATTCT
CAACATTAAATGTTTATCAACCATCATCAACAAATTTAACCTTCAGCAATTTCTACAAAT
CCAAATTTATTTCACCCTCATTCTTTCAACTAATAAATGTTTACCTTCGAAAGCCCTAGC
AAAAACCATTTCAACTCCAATCTTAGCTATGGTAACATGGCACAAGATTCTTATACTTAT
AACATATAAAATCAGTAAACTAATTAAATCATCGGCACAGCGCGTTTCCGTGCAATTGAT
GAAAATTCTCCTTTTATTACAACTCTAGATTAGCAACAAAGAAACTCGAATACACTCATG
TAACATGATGCATTTTTGACATCGGGACTTATGAACAATGAACAAAGTATATTCTAAACT
GGTGTCTAACCTAATCAGAATTCAATGGGCAATCCGAATATCAACGTAGATCCCAGCATT
TTTGACTTTTAAGATGAGAAGTGGAAATAACAATTCTTCTGA


>Contig22230.0.g52(protein)
MDQRIVNPYEGGFSTQQPQQPGTDLGQPRPFTNFQFVQGQNNFIDSQDEEEKGDDYGMMN
PLILRDFQVGEIKSRSSTGSLLSENSESSIESHYSKASNWTKGRSRQRLKVPTSLKNNNQ
ISKGVKERKSITKSSYPERSESGSQQDLPIVKQDVPNQIQVMYDISGTVIPPKRPLSPYI
FFSQEQRKILKGTHPNWSTKQIMRVVSTKWKQMSDDQKNGYKVLSDSDRRRFDQEKKLQK
GSKRRKKGKVQEDLGVLQTIDELKEEENFQEGVLLPENQKKPRKEKEVKQVKRKVQSSHH
NFMMQSQSQQLHPQNAAMNNTSVNHINIVNNLLVCNNDGVQQLLHHQQQPPHQFDQSRDE
FQIFKNMQQSAQQYSFNDNSQHQMFINHHQQIQPSAISTNPNLFHPHSFNQQMFTFESPS
KNHFNSNLSYGNMAQDSYTYNIQNQQTNQIIGTARFRAIDENSPFITTLDQQQRNSNTLM
QHDAFLTSGLMNNEQSIFQTGVQPNQNSMGNPNINVDPSIFDFQDEKWKQQFF