Identifiers and Description

Gene Model Identifier

Contig4762.0.g43

Standard Name

HIT1

Aliases

Contig4762_0_g43

Description

HIT zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012985900.00000000000008999700526206354HIT zinc finger family protein
SGDYML041C0.000030009396760408108VPS71 SGDID:S000004505, Chr XI
II from 195755-194913, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4762.0.g43(coding)
ATGGAAGAAATTTAAAAGTCTAAATAGCATACAAAAAAGACAAGAAGCTCCTCAAGATCT
AAAAAGCTTTCTTCTGCCATGAGAGTGGTTGATGATGAAACTCGAAGAATTATCCAATAG
AATAGGATAGATGCTCTGGAGGCAGATAATTTATTCGAAAATCTCAGAGAGGAGGAAGAC
GAGCAAGCTCTAGACGATGAGATGTGGGACGATTACGCAGGGGGTTCCGGGTCAGATCAA
GAAGAAAACAGTATATTCTAAAACAACTCCTCTACAAACACTGGGAAATCAAAAAAGGGA
AGAAAAGATGCAGTTGGGGGAACAAGTAATCAGAGAAAAACTAGGTCTCAGGGATAGGAT
ATATCCAAAAGTTTGTTACAATAAGCCAGGATGGCATCATCTAATATATCTAAAGAGAAT
ATTGGGAAGAAAGGGTAGAGAGGCAAAATTGATTTGGCCAAAGTGTTTTACTAGGAGTTT
TATGTCAATGAATAGTTCATGAATTTTCCCAATTATCTCTCTGTAGCTGCGAAGCCAAGT
AAATTTCCGAGAAGATTTTTCTGTTCAGTTTGCGGGTATAACTCAAAATATCAATGCACA
AGATGTGGATTGAGATATTGCACTATGAAATGTGGAGAGACTCACAGAGAAACAAGATGT
ATTAAATTTGCAGAATGA


>Contig4762.0.g43(protein)
MEEIQKSKQHTKKTRSSSRSKKLSSAMRVVDDETRRIIQQNRIDALEADNLFENLREEED
EQALDDEMWDDYAGGSGSDQEENSIFQNNSSTNTGKSKKGRKDAVGGTSNQRKTRSQGQD
ISKSLLQQARMASSNISKENIGKKGQRGKIDLAKVFYQEFYVNEQFMNFPNYLSVAAKPS
KFPRRFFCSVCGYNSKYQCTRCGLRYCTMKCGETHRETRCIKFAE