Identifiers and Description

Gene Model Identifier

Contig18445.0.g39

Standard Name

HINT1

Aliases

Contig18445_0_g39

Description

HIT domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006861806.00092892288903e-46HIT domain containing protein
SGDYDL125C0.00000005001214305021125HNT1 SGDID:S000002283, Chr IV
from 239398-239019,239606...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18445.0.g39(coding)
ATGGAAGATAATAACAACAACGACGAGGCTCAGAAAGCTCAGACTGCTCAAGAAGAGGAA
GTCACTATTTTTGATAAAATAGCCAGAAAAGAAATTCCAGCAAACATCATTTATGAAGAT
GATATTGCTATGGCATTTAGAGATGTAGCACCAATTACACCTACTCATTTCCTCGTTATT
CCAAAGAATCGCAATGGATTGAGTCAGTTGAGAAAAGCAACCAAGGCTCACATCGGCCTG
CTTGGTCATTTGATGTGGGTAGTCGGTCATGTAGCCATGCAAGAGAATCTTGAAGAGGGT
TACAGAGTTGTCATTAATGATGGCAAGCAGGGTTGTCAATCTGTTTATCATTTGCACATT
CATGTAATCGGTGGTAAGCAACTTTCCTGGCCCCCAGGTATCTGA


>Contig18445.0.g39(protein)
MEDNNNNDEAQKAQTAQEEEVTIFDKIARKEIPANIIYEDDIAMAFRDVAPITPTHFLVI
PKNRNGLSQLRKATKAHIGLLGHLMWVVGHVAMQENLEEGYRVVINDGKQGCQSVYHLHI
HVIGGKQLSWPPGI