Identifiers and Description

Gene Model Identifier

Contig12447.0.g96

Standard Name

HELQ1b

Aliases

Contig12447_0_g96

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL251C0.00003998524687536623HFM1 SGDID:S000003220, Chr VII
from 31426-27921,31636-3...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12447.0.g96(coding)
ATGAACGAACCTGTTATTTAAAATTCATTGGTTGATATTTTGTCAAACTAAAATTTCCGC
AAATCAGATATTTCCTTATCACTCAATGAAGATGACATGAACATGTTATTTTCACAATCC
TAGATAAGGGATAGCAACATAGGATTAAATGATCAAGCTTAGACAAACAAATCAACAAAG
AAATAAATCGCACTTTAAGTATAAGACGAAGATGATTAATTTTTATAAGAGAATATGAGC
GAGATCTTTTCAAGTCAATCCCCATCAAGATAAGCAAGCATAGCCAACTAAAATTAAAAT
GATCAATATTAGTCCAATTTCTAGTAATACAATTAATCTGGGATGTCTTTCGATACGAGG
ATGCTAGAAGGATTGCTCTCCTAAAATGATGATATTTCTTAATCAAACTCAAATAAAAAC
CATGATAAGTTTAGTGTAAATAATAATCCGCAACCAAGTAACTTTCCATTTGCTAATAAT
CCGTTTAAGTCATTTAATAACTCAAACTTAAATAAAAAGAGAACAAATTAGTTCCAATTC
TCCAGCAATAAAAAGTTGGTAAATAAAGTAAGAAATAGTCACATTGTATAAAATGATTAC
TAATTATCAGTTAATAATAGCTCAAATGTTATGTAAAATGCCTCTACCAATAAATAAAGT
GTACAATAATTTATGGGATTAAGGCCTTCAGACACAATTATGAGAGATTTATAAGATTTA
AGTGAAAATGATGATGTGTCTTTTAGAGAGTCTATGCTAGATAACGAGCTTGATGAATTG
ATAATAACAAATAATTTTGATGATGAAATTAGGCAATTTCAAAATCAATAAATTTCAAGT
AGTGACAACAAAATGATCAACTAACAAAGAGATTTGTAAGAAGTGATGTTTATGAATGGA
TCAATTATGATATAAGAGGAAGTAGATGATATATAATTCTCTTAAATGAGTCAAATTTTC
AGTTAAAGTATTAGACAGAGTTCAGCTTAGTATAGTAATAAAAGCTAAAACAAAGTTGAT
TAATTAGACATTTAAAACTTGATTTAATTTGATATAACATAAGATATCATAAACATAATG
AGAGACAAATTCAAAATTAAGCAGCTCTTTGAGTGGTAGTATGACTGTTTTTCAAACAAA
AAGGTTTAGCAAGGAGGTATTTTTTTTCTTAATTTATCTTAAATCTTTTTAGAAAACTTA
ATCTACTCAGCTCCAACAAGTGCAGGAAAGACTTTAGTTTCAGATTTAATTATGATGAAG
AACTTAATAAAATATCCAACACTAAAAACTATAATTATCATGCCCTATGTCAGTTTAATA
GGAGAGAAAGAATATAAGATTAAGTAGTTACTATAGACTTTAAATATGTAAATTCAATCC
ATTCACTCGCATAAAAACGAACTTCATATGATTGGAGATGAATCTAGAGGTTATCTGCTT
GAACTTATGTTATCTAAATTTTAATACCTTAATTCTACCATTAAACCTCAATAACTATCA
AACAAGCTAAGCCCTTACGTGAACCTTGATTAGAAAATTTAAATCATTGCAATGAGCGCT
ACTTTTCCAAATTTATAAGAAATTTCTTAATGGCTAAATGCTGAATTGTTTGTAACAAAC
TTCCGCCCAGTATAGATTAGTGAATTTTTAAAAGTTAGTAATGAACTTTTAACGCCTGAT
GGAACTTAGCTTATTCGTAAACTTAACCCTAATGTACCATAGATCTTGAAATAAGATCGT
TTAAATATTTTCCAATTAATTCAAGAAACTCTATAATAAAATGGTTCAATATTAGTGTTC
TGTAGTTCTAAAGATAAATGTGAAGAATTTTGCAGGATATTAATGCTTTCAATTAAATAA
TGCTTGGAGAGTATTGGAATAGTTCTTACAAAAGAAGTCTTGATGAATTGTATAAATGAA
CACTTAAGAGAGTTTCTTTCAAATAACTTTTACTAATTGCTTGAAAAGGGATGTGCATTT
CATCATAGTGGTTTGGCAATGGCAGGTAGGTATGGTTTTGACACCGAAGCAGATTCTATT
CTTTGTGTATAAAATCAATCAGAAAAGAAGAAAGCGATTGAGCTAATGAATCGAAAACTT
GAGAGAATCAATTCATGCTTAAACATAGAGAGGAAAGGGCTATCTCGAGTTATCTTGGAG
TCTATTGGCACTAAAATTGTACAAGATTCAGTGTAAATGAAACTATTTCTACAAAATACT
CTGCTGTATACTTAAATTAGCAGCTTAATTGTAGAGGAATCATAGGGTAAAGATTAATAA
CTTAACAACATTGACTTAGAGCATTAAGCTTGGGTTTAAATGTAAAAGTAAGGTAAACAA
GCACTGGATTTCTTGATTTTTAATGAAATTGTTGTGCAGTAAGCTTAAATGATAGAAAGG
TAACTTCACTTTAAATTTGAGACAACCAAACTAGGCTTAGCCATTATAAAAAGCAATTTA
TCTCCAGAAGATGGACTGATGGTATATATAGACCTCTAAAATGCTCAATAGAGAATAGTT
CTACAAAATGAACTTCACCTATTATACCTCATGACACCAGTGTCGAATACCTGCATTAGA
ATAAACTGGGAGCTTTTTCATTGGATATATAGAAACTTAGCTCCTATAGAATTGAAGATA
TGCGAGCTAATTGGAATAAAAGAAGATTATATAGTTATTTTGAATGATTAAGAAGATAAA
GGACTTGTGAGTGGTATTACAGATTTTAAGGCTTTTGCTGAAGTAAATAAAGAGCTAATT
ATTAGAATGAGACATGCAAGATTCTACTCAACCATCCTTCTTAAGGATCTCTTGAATGAC
TATAAAAATGAAGAAGTCATGTCGTTTTATAGAATTACCAGTGGAGACATATAAGCTTTT
CAATAGAGATGTAGTGCTTTTAGTTCGATGGTAGTTACATTCTGTCATGAATTGAATTGG
TGGAATATGTATAACTTGTTGAACCAGTATATGGACAGAATCAATTTCGTCGTTTAGGAA
GAGCTTGAAGAACTTCTCTAGTTAAGTGTAATTGATGCTCCCAAGGCAAGAGCAATTTAC
GAATCAGGTTTTACGAGTATATATCACATCTCGAAAGCCAGGCCTATGGACATTCTCAAA
GCTTTATAAAAGACTCTTATCATCTAGAGATAGTTTTCAACTGACATGGAAGATTTATTC
AAACAAGGTACTACTGAGCACTCTTCAGCAACTATTTCAAAAGCTGAGGAAATTATCTAA
GCAGCAAAGAATATCATGAGAGTTAGGAATTTAGCCAGAGCCAGGGAAATTATTAAGAAA
AAGAGGGAATGGCTTAAATAATAAAAAGAATTATAGAATAATGAGATGTAGAAACTTCAA
TAACAATAGTATAATTAGCAGTGA


>Contig12447.0.g96(protein)
MNEPVIQNSLVDILSNQNFRKSDISLSLNEDDMNMLFSQSQIRDSNIGLNDQAQTNKSTK
KQIALQVQDEDDQFLQENMSEIFSSQSPSRQASIANQNQNDQYQSNFQQYNQSGMSFDTR
MLEGLLSQNDDISQSNSNKNHDKFSVNNNPQPSNFPFANNPFKSFNNSNLNKKRTNQFQF
SSNKKLVNKVRNSHIVQNDYQLSVNNSSNVMQNASTNKQSVQQFMGLRPSDTIMRDLQDL
SENDDVSFRESMLDNELDELIITNNFDDEIRQFQNQQISSSDNKMINQQRDLQEVMFMNG
SIMIQEEVDDIQFSQMSQIFSQSIRQSSAQYSNKSQNKVDQLDIQNLIQFDITQDIINIM
RDKFKIKQLFEWQYDCFSNKKVQQGGIFFLNLSQIFLENLIYSAPTSAGKTLVSDLIMMK
NLIKYPTLKTIIIMPYVSLIGEKEYKIKQLLQTLNMQIQSIHSHKNELHMIGDESRGYLL
ELMLSKFQYLNSTIKPQQLSNKLSPYVNLDQKIQIIAMSATFPNLQEISQWLNAELFVTN
FRPVQISEFLKVSNELLTPDGTQLIRKLNPNVPQILKQDRLNIFQLIQETLQQNGSILVF
CSSKDKCEEFCRILMLSIKQCLESIGIVLTKEVLMNCINEHLREFLSNNFYQLLEKGCAF
HHSGLAMAGRYGFDTEADSILCVQNQSEKKKAIELMNRKLERINSCLNIERKGLSRVILE
SIGTKIVQDSVQMKLFLQNTLLYTQISSLIVEESQGKDQQLNNIDLEHQAWVQMQKQGKQ
ALDFLIFNEIVVQQAQMIERQLHFKFETTKLGLAIIKSNLSPEDGLMVYIDLQNAQQRIV
LQNELHLLYLMTPVSNTCIRINWELFHWIYRNLAPIELKICELIGIKEDYIVILNDQEDK
GLVSGITDFKAFAEVNKELIIRMRHARFYSTILLKDLLNDYKNEEVMSFYRITSGDIQAF
QQRCSAFSSMVVTFCHELNWWNMYNLLNQYMDRINFVVQEELEELLQLSVIDAPKARAIY
ESGFTSIYHISKARPMDILKALQKTLIIQRQFSTDMEDLFKQGTTEHSSATISKAEEIIQ
AAKNIMRVRNLARAREIIKKKREWLKQQKELQNNEMQKLQQQQYNQQ