Identifiers and Description

Gene Model Identifier

Contig18825.0.g70

Standard Name

HELQ1a

Aliases

Contig18825_0_g70

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJL050W5.9971655715910366e-21MTR4 SGDID:S000003586, Chr X f
rom 342522-345743, Genome...
T. thermophilaTTHERM_003020601.9991095569230066e-20Type III restriction enzyme, r
es subunit fami...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18825.0.g70(coding)
ATGAATAATAAGTAAAGTGCCAATTAAAAGTCTTCCACAGGTCCTGATAAGTTTCCCAAG
GTCTTTGTAAACGATTTAGACAGCGATATAGATGAAGAATTGGATAATTTGATACTTTAA
ACTTTCCTTAATGATGATAAAAATTAACAAAGCGCTAAAAAAGCAAATTCAAATAAAACT
GATCAGAAAGTTGCTCAAAATATTGATTAATAATCAAAATTAATTGGTAGTAGCTAGTAT
AATTCATGCAAATTAGTACCTCAAAATGATAGCAATCAGAGCCACAGTTTTTAATAGTAG
TAGTAGTTGTAACAAACTTCACAATCCAATGCTAATCAATAAAATTTAGTAGAAAGTGAA
GGCTAGAACTCCAGGCTTTTACATCCAGAGATATATAACACACAACTTTTGAGAGTAAAT
AACGGCAATATATAGAACAAAAATCAACATTAATAAACTCATTCATCAGTTCAGCATTAA
TAAGTCTTCGATGAAAACTCAAACCTTCCATTCTATCACAACTCTATATAGAAACGTAAA
CTCAACAATGATTTATAATAAAATAATCAAATCAACTCAGTGATTTAAGTATAAAATCAC
AACTAATAACCTTCATAAAGTAGAGATTAAATTGAGCTGTAATAGTAGAAGAAGTCGAGT
GTACATTAGAAATAAAGTAAAGTAGTTAGTGGGTTTTAGTTCAAATCTACTGAGAGGAAA
AATAAAACTGGGGTTTAGAGGGTATTCATTAATGAACCTGATGAAGAAGAAAAATAATAG
AATTATGTTCCTGGGCTTTACTCAAACTACCAGTAGCTGTATCAAACTCAGAAACCAGGA
TTTTCAGCAATTGCAAACAATGCAGTCTAATCTGATCTCTCAAATCACAATTTAATCGAT
AATAAAAAGTCGAGAGTAAATAAGGCTTTGAAATTATTGAGAGAAATGAAGACTAAACCT
CGTTATAAAGATAAATATGGAAATAATGTAAAGTAGCATTTTGGCATATACAAGTACTTT
ATAAACACTTAAACCTAAGAAAAAGAAAAATTTTACATTTCACATGAATGCCAGAAAATA
CCAGCATCCCAAGCAATGAAAACTCAATAAAAAGAGATGGATATATTGGCTCAGCATAAA
TATCACTATTACGAAAGTATCTAGAAAACAGGGAGAGTGGTTAAAGATAAGAATCGCTTG
GAGTATTGGGGCTTACCAAGTGGCATATGTGACCAGTTTTACAAACATACAAAAATCTAG
AAATTATTCGATTGGTAGAGTGAATGCCTTAGCTAAAGCAAGGAAGTGCTAGATGGCAAA
AAGAATTTGATATATTTTGCTCCTACTTCAGGTGGAAAAAGTGTTGTGGCAGAACTATTA
ATGCTCAGATAGATACTAGGTTATAAAAAGCGTGCAGTTTATGTACTACCCTTTGTTAGC
ATAGTAACTGAAAAGCAACAATATCTCACAAAGTTATTGGAGAACGTCAATGTTAAGATA
ATTGGCCTGCACTCTCAGAGTGAGAATGTGTGGTCACCAGGAGTAGACATAGCAATCTGC
ACGATAGAGAAAGCAAACAGCCTGCTCAATAGAATAATCGAAGAACGTGCGTATTTTGAT
GTTGGCTTCTTCATTATCGATGAGTTTCATTTAATTCTCGACGAAGGAAGAGGATATCAA
TTGGAGTCTCTAATTGCCAAGTTAAGGACAGTTGAGACAATAATGAATAGGGAAAAGTCT
TTCTAAATCGTAGGAATGTCAGCTACACTTTCAGGTTTAGATTATTTAAAGCAATGGTTT
GGTGGAAATTGTGAGCTTTATGAGTGTCAATTCAGACCAGTTCCCCTCTCCGAATATTTG
CAAATTGGCAGTAAGCTGTTCAACAAAGAAATGAAAATGATAATGGACTTGTCTCATTTG
CCTAAGTTTCAAATGATTGATTCGAATGGTAGAAGTTAAACACTTGCTGCTGACAATGAT
TATCTTCCACTTGTTCTAAGTTCGTATTTGAGGAAGAAAAAAGCTGTTCTCATATTTTGC
CCTAGTAAAGTTTAATGCGAATAAGTGGCCAAGAAATTGGCAGCTATAATGCCAACTTAA
TACCCTGAATATGAGTCTAAATAGTCACTACACTATGAAGATATAGAAACAGAAATAAAG
GAGATTGGTTATAGAACCGGTGCTTTGTTAGTACTCGCAGCTACATCGACTTTAAGTACA
GGAATAAATCTTCCAGCTAAAGCTGTATTTTTCAAAGGACCTTATATAGCATAAATGCCA
ATGGATGCAGCTAAATATAAACAGATGAGTGGAAGAGCAGGGAGGACAGGTTTTGATTCT
AAAGGAGATTCAATTATGATGTGCACAAACAATGACAGGGAATATGTGTTAGATCTAATG
AAGCCATTTTACTGTGAGCTTAAAAGTGCCTTAACTGGATAAAGATTAATGAGATCATTG
TTAGAAATAATTGCAAGCAATGTAGTCACATCATTCAAGCATATAAGAATCTTCATTTAA
TCAACTCTGAAATACACTCTTTGCCAGAAAATGAGATGCAACTCTTGCACCCAAACTTAC
TTTTAAAATGAAATCTTGTTTGGTGTCATATAAATTTCAGATGAAGCTTAATTGCAGAAA
GTTTAAAATCAATATAACTTGTATCTAGAAACCTTTCGCCTTGAATAGTTCAAAGATGAG
ATTTAGGATGATGACTGCAAGAATTGCATGCTGGAGTTTTCTAAGCAAGTCGTGGCTTAC
TTAAGCAAATTTAAATTCTTAACCTTTAACCCAGCTGAGGGTACTATCCTGCCTACTTAG
CTTGGTAAAGCTGCTTTTGCTTCTTCAATACCACCAGAGCATGGTCAGAAAATCTTTGAA
GATTTAGCATAAGCAAGAGGCAATCTGGTGCTTGAGACTGACCTACACTTATTATACTTG
ATAACTCCTCATTTCAAACAAATCAGAGAGCCAAACTGGGATGCTTTCATTAGGAAATTC
AGTAAACTGTCGAAGGGTGAGAAGAACGTTGCGGAGTTTTATGGTTTGGATATGGAATAC
CTCTATAAAGCCACTGTTTACCCACCAAAATTACCTGTTTGCCTTCAAGATCCGAGTAAT
AGCAATGGATCATCATCCATGGCGCAAAGTAAAGGACTAAATGCACTTTCTCTGAAATCT
AAGATGGAGAAACAAGCAACTCTAACTCAAAGTACTATGAATACCAGCTCAGTTCATAGT
AAGGACTCTTCAGCATTAGACATATCTTCAATACAGACTCCTTCTATGACATAAATGGAC
CAACTAATATAACTGTAACAATTGACTGCTGAAGAATAAAAGCTAGTGAGATACTGTAAA
TTCTACATGGCAATGATAATGAATGAAATACTCAAAGAAACCCCACAAAATGAGATCTGC
AATATATTTAACATTAAGAGAGGTGATATCCAAACTATTCAAGCTCTAGCAGTTAACTAC
TCTGGTATGCTCTCTGCTTTTTGTGAGAGATTATTCTGGTCAGATTATTCAGTCTTGCTT
ATGAGAATTAATGAGAAGATTAATTGGTGCGTTAAAGAGGAGTTACTTGACTTGATGTAG
TGCTCATCTCTGCGACCAGAACGAGCCAGAGCTCTCTTTACAGCAGGCTATGAAACAATA
GAGGATATTGCAAAAAACGGAGAAATAGAGAGTATGGTGAAAATATTCGATAAAAACGAT
GGGTTCATGAGCCACCGCAAGTCAAACGAAGGTGACCTGAAGATGCGCTACGACTATTAC
TACACTCTCGCTCATAAAGTATTCTGTGAAGCTAAAATGATCATGGTCAAGCGGAAAGTA
GACCCTGACAGGACTATGATGAGTTACATGCAGGAGCAGCAGCAATTCGTTGATGTGGAT
CAGAGATATGTGCTGGATTCGGACTATAGCAGCAGCGAGGGAAGTGTATTGGAGGGAGAT
GATGAATAAGAGATTGAGGAATTGGCCAAGTTACTTGAGGAAAATGGTGAAGATTTAGCT
GATTTAGATAGCGACAGCGATGATAATACGAATAAACAATAAGAAAAAGATGTAATCAAT
AATAACAATAGTAAAAAAAAGAAATCAATTTAAATGAATAAAATTGATAGTGATAGTGAT
GACATTGACTTGGATGATTTCGCTGATGATTCCGATGATGATAATAATGAATAAGATATC
AGACTGCGAGGTTTATAAGCTAATCAATCAAATAGAAACCAACATGATATGATAAATGAT
GTACACATCTAAAACACAGTCAATTAACAACTGCAATTATCACAGTAATCCAATAATGAT
ATTTATGATGAAGATTCTAGTAGCTTTGATCTCATAATAACTCACTCCTCAGATACATCT
CCTAATAAAAAAGAACAGTAACCCAAAAATCATAGTTAAAATCCTAACACTAATGACATT
CATAGTAAGAATAATAATAGTAAGAATGACATTGACTTGCTATTGAACCAATCTATTTCC
ATTTCTTCTGATAATTCCGCATCTGTCAATCACTAATAAGTTTCAATTAATGCTCAAGCT
CAGTAAAATAATAACTCCTTGAAGTAGATATTTGACTATAACTGCAATAGTAGTAACAAC
AACAGTAATGATAGAAACAGCAATAATAACAGTAAACTTGTTAGCATTAATTCAATAAGT
GATAAGAACAATAACCCCCCATAATTGTAAATCTAAAGTAAAATATAAGTGAAAAGTGAT
CCTGCTGTTGTTAGGTATAGTGATGTAAGCAGTGGCAACTTGCACCTGAGTGATATCGAT
TTATTTTCAGCACTCCCTGATTTAGATGCTGATAACAACATTAAACAACAAGATACTGGC
AACATTTAACATGCAGAGAATGAATTGGATGATGATGATCTTGATGATTATGAATTAGAT
TAATTGTGTCGTGATGATGAAGATGATAGTGGATGTGATGATGTAATCCAGGGTAAATCC
TCAAGAAAAGGCAGTAAGAAGAAACAAAGTAGTGGAGATCAATTTCATGACGAGGAGGAT
GATGATGATTAACTTTTGGATGAGATGTGCTAGCTTTTGGAGGATAACAGTCAGTGA


>Contig18825.0.g70(protein)
MNNKQSANQKSSTGPDKFPKVFVNDLDSDIDEELDNLILQTFLNDDKNQQSAKKANSNKT
DQKVAQNIDQQSKLIGSSQYNSCKLVPQNDSNQSHSFQQQQQLQQTSQSNANQQNLVESE
GQNSRLLHPEIYNTQLLRVNNGNIQNKNQHQQTHSSVQHQQVFDENSNLPFYHNSIQKRK
LNNDLQQNNQINSVIQVQNHNQQPSQSRDQIELQQQKKSSVHQKQSKVVSGFQFKSTERK
NKTGVQRVFINEPDEEEKQQNYVPGLYSNYQQLYQTQKPGFSAIANNAVQSDLSNHNLID
NKKSRVNKALKLLREMKTKPRYKDKYGNNVKQHFGIYKYFINTQTQEKEKFYISHECQKI
PASQAMKTQQKEMDILAQHKYHYYESIQKTGRVVKDKNRLEYWGLPSGICDQFYKHTKIQ
KLFDWQSECLSQSKEVLDGKKNLIYFAPTSGGKSVVAELLMLRQILGYKKRAVYVLPFVS
IVTEKQQYLTKLLENVNVKIIGLHSQSENVWSPGVDIAICTIEKANSLLNRIIEERAYFD
VGFFIIDEFHLILDEGRGYQLESLIAKLRTVETIMNREKSFQIVGMSATLSGLDYLKQWF
GGNCELYECQFRPVPLSEYLQIGSKLFNKEMKMIMDLSHLPKFQMIDSNGRSQTLAADND
YLPLVLSSYLRKKKAVLIFCPSKVQCEQVAKKLAAIMPTQYPEYESKQSLHYEDIETEIK
EIGYRTGALLVLAATSTLSTGINLPAKAVFFKGPYIAQMPMDAAKYKQMSGRAGRTGFDS
KGDSIMMCTNNDREYVLDLMKPFYCELKSALTGQRLMRSLLEIIASNVVTSFKHIRIFIQ
STLKYTLCQKMRCNSCTQTYFQNEILFGVIQISDEAQLQKVQNQYNLYLETFRLEQFKDE
IQDDDCKNCMLEFSKQVVAYLSKFKFLTFNPAEGTILPTQLGKAAFASSIPPEHGQKIFE
DLAQARGNLVLETDLHLLYLITPHFKQIREPNWDAFIRKFSKLSKGEKNVAEFYGLDMEY
LYKATVYPPKLPVCLQDPSNSNGSSSMAQSKGLNALSLKSKMEKQATLTQSTMNTSSVHS
KDSSALDISSIQTPSMTQMDQLIQLQQLTAEEQKLVRYCKFYMAMIMNEILKETPQNEIC
NIFNIKRGDIQTIQALAVNYSGMLSAFCERLFWSDYSVLLMRINEKINWCVKEELLDLMQ
CSSLRPERARALFTAGYETIEDIAKNGEIESMVKIFDKNDGFMSHRKSNEGDLKMRYDYY
YTLAHKVFCEAKMIMVKRKVDPDRTMMSYMQEQQQFVDVDQRYVLDSDYSSSEGSVLEGD
DEQEIEELAKLLEENGEDLADLDSDSDDNTNKQQEKDVINNNNSKKKKSIQMNKIDSDSD
DIDLDDFADDSDDDNNEQDIRLRGLQANQSNRNQHDMINDVHIQNTVNQQLQLSQQSNND
IYDEDSSSFDLIITHSSDTSPNKKEQQPKNHSQNPNTNDIHSKNNNSKNDIDLLLNQSIS
ISSDNSASVNHQQVSINAQAQQNNNSLKQIFDYNCNSSNNNSNDRNSNNNSKLVSINSIS
DKNNNPPQLQIQSKIQVKSDPAVVRYSDVSSGNLHLSDIDLFSALPDLDADNNIKQQDTG
NIQHAENELDDDDLDDYELDQLCRDDEDDSGCDDVIQGKSSRKGSKKKQSSGDQFHDEED
DDDQLLDEMCQLLEDNSQ