Identifiers and Description

Gene Model Identifier

Contig10573.0.g71

Standard Name

HEL2

Aliases

Contig10573_0_g71

Description

Helicase conserved C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYMR190C2.999661265281073e-47SGS1 SGDID:S000004802, Chr XII
I from 645258-640915, Gen...
T. thermophilaTTHERM_010300001.0003292389192957e-45ATP-dependent DNA helicase, Re
cQ family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10573.0.g71(coding)
ATGTCAGAAGAGTCAAGTCACATACAACTCATCAAAAATTCGGAAGAGCATCCAAGTAGT
ATTTCTGACAAACAAAGCGATGACTCATTTATTGAATAATTGGACAACATGGTCATTGTC
GATTCAGAAAGCGATGATGACGATCAAAGAAATATTTCCTTGGCACATGAGGATCTGAGC
ATTTAATAAAATTAAGGGGTATAACCAAATATTCCTCCTAGCAATTAACCACTTAGACTT
AACTCATAAGATGAAGAAGAGCTGAAAGAGGGCTCCGGAACATTAACTTGGGACAATAGA
GTTCAACATTTGCTGAGAAGCTTTTTTAACATCTCAGAACTTAGACCTCAATAAAAAGAA
GTCTTAAATGCAGTATTAGCTCAAAAGAATGTGATGGCTATATTACCAACAGGTTCAGGG
AAATCTCTATTTTTCTAGCTACCTTCTTTTATTGAGAAAAAAGGAAAGTTACAACGCTTT
GTTATTGACGAATTCCATTGTGTTAATTAGTGGGGAGAAACTTTTAGGTCTGACTATGAA
TAACTTAAGATTATTAAGCAGAAATTCAAAGATATTCCACTTCTCTTCCTGAGTGCCACA
TGCACCCCTTACACTTAGGATTACACTTTAAGGAAATTCAATATTTGCACAGATGTAGAG
GTGTTCAGATATTCTTCAAACAGAGAGAACATAGTATTTTCTGTAAAAAAGAGAGGTACA
ACAGCAATCAAATAAATCATAGAATTTATGAATAAATTCCAGAACGAGTCCGGAATAATT
TATTGCCAGACAAGAGAGGATTGCTAACAAAATAGCCAAATACTTAAAACGTTACATGGT
GTTAGCTGCGACTTTTATCATGGCGGTATGGATGGTATTTAGCAGCGTAGAGTCTATGAG
GACTGGTTGAACAATAGGATTCGTATTGTCATTGCTACATCTTCATTTGGTATGGGCATA
AATAAACCTAACGTAAGATTTATCATCCACATGGCAATGCCATAAAATATCCAGGACTAT
TCCCAATAGTGTGGAAGATCTGGTAGGGATAACTCTGCCTCTGAATGTTTGATGCTATAC
GATAGCCAAGATAAGAAAATGTTTTTGAAAAATATCAAAAAAAGTACCTACAAAGACGAA
TAAGATTATTACGAAGAAGCGAAAATCGCATTTAAACTTGTAGAAAATATCAACTCAAGT
GAAAATAGGATAACTTTCAATCAAGCAATAGATGTGCTAAATGGAAACAAATTAAAGAAA
ATCAAGAAATCATCAAAGTTTCTAAGGATAACATAAGAAATGAAAGGGCTTCTTAAGGAA
ATGAAGAGAGATAATATTGAGAGACTACTCTTAAAGATGTTACTCTCTGGTATTCTCGCA
GAATAAACATGTCAAATAAAACTCAAGGATGAAGAGGATGTGAAACATGACTATCTCGCC
ATAGGGGATCCATAGATTTGCAAATCTTTCTTTCAAAGAAGAATTAAAATAACTATGACA
ACTCCATATATCGACCCAAAAAAGTAGAAAAAGTAACAGCCTGAAAAGAAAGTTGATCCT
AACATTTAAAAGTCAGGAAAAATGAATGAGGGAAATTCTGAGAACTTCTAGTAATAGAAG
ATGGGCTAATAACTTCCCAGAAATTAACCTAGTTCAAATCAAAGCAAAGAGAACTCCTCC
AGAAATCATCAATAACAGAGAGATAATGTCGACCCTATCGTAGATTCTAATAAAGGATAG
GATCAAGATAGATTTGATTTGTAAGAAGTTTAGTCACAAAATATATCAAATGACTTTGCT
TTGTAAATCAAATAATATATGGATGATTTCGTATAAAAGCTAAACTCAGAATTAAGCATT
TCCACACTGAACTCGGCCTTCAGAGATGAAGGACTACAAGATTTTTTGAATTTTGTAAGC
AATAATCCTGAATCAACTTCCCTTCAGGATATCATCTAACTTTAAAAGTATGGCAAACCT
AAGCTGATCAAAAGTGCCATAGCTTTACACGTAGTTCATAATACTCCAACCCATTTAATG
TTCAAAAATAAGATAATCATTATCAAAATTAGGATTAAATGTAACTTGAATTAACTTCTG
AGCAAATCATGA


>Contig10573.0.g71(protein)
MSEESSHIQLIKNSEEHPSSISDKQSDDSFIEQLDNMVIVDSESDDDDQRNISLAHEDLS
IQQNQGVQPNIPPSNQPLRLNSQDEEELKEGSGTLTWDNRVQHLLRSFFNISELRPQQKE
VLNAVLAQKNVMAILPTGSGKSLFFQLPSFIEKKGKLQRFVIDEFHCVNQWGETFRSDYE
QLKIIKQKFKDIPLLFLSATCTPYTQDYTLRKFNICTDVEVFRYSSNRENIVFSVKKRGT
TAIKQIIEFMNKFQNESGIIYCQTREDCQQNSQILKTLHGVSCDFYHGGMDGIQQRRVYE
DWLNNRIRIVIATSSFGMGINKPNVRFIIHMAMPQNIQDYSQQCGRSGRDNSASECLMLY
DSQDKKMFLKNIKKSTYKDEQDYYEEAKIAFKLVENINSSENRITFNQAIDVLNGNKLKK
IKKSSKFLRITQEMKGLLKEMKRDNIERLLLKMLLSGILAEQTCQIKLKDEEDVKHDYLA
IGDPQICKSFFQRRIKITMTTPYIDPKKQKKQQPEKKVDPNIQKSGKMNEGNSENFQQQK
MGQQLPRNQPSSNQSKENSSRNHQQQRDNVDPIVDSNKGQDQDRFDLQEVQSQNISNDFA
LQIKQYMDDFVQKLNSELSISTLNSAFRDEGLQDFLNFVSNNPESTSLQDIIQLQKYGKP
KLIKSAIALHVVHNTPTHLMFKNKIIIIKIRIKCNLNQLLSKS