Identifiers and Description

Gene Model Identifier

Contig271.1.g43

Standard Name

HEATR1

Aliases

Contig271_1_g43

Description

U3 small nucleolar RNA-associated protein 10

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002160607.000402845995459e-29hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig271.1.g43(coding)
ATGATATAAGTAGTAAACCTAAAGCAAGATGACTATTTCTAATTCTTGGAACAATTTGCC
TTCAAGGGTTAAGCTTTAGATAAGAATATTCTGATTAAAAGTCTTGCAAGAAATGATGCA
ATCGTATTCTCAAAATACTCATAGTTCTGTTTTGACTTAGCTGATTTCCATCAAGAAATT
AGTGCTTCCTTGATCTCTGTAGAAAGCTGCCTTCACTGGAAATTCTTTGGAACTATGTTA
AGTGAGGTGCTTAAGAGTCAAGCTGGCTAATCTTAAACAAGTCTATTCAACTTGCTTCCT
TTTATTTCAAAAGCGATGAAATCAGAAATAAAGGACTTTAAAATCTCATCTTATATGGCT
ATATCCTAAATATCTTGCAGAAGATCACTCTCTACTGAGTATGCTAGTGCCTTCTTCAAG
TAGGTGCTTCTCAGTTTGAAAGATCAATAAAATGAAGAGTACATTGAAAAAGGCATATTA
GTAATTAGCTTAATTATTCAATACTAAAACATCAAGATGATTGATGAAAAGGATGTCAAT
CAATTTTTATAAATATTCAGAGTTTAAAAACTAATCAAAAGAATGGCAGATTAGTAAGAC
TTATCATCACTACTCAAAACTATCATGACTTCAACCCTTGTTCAAACAACAATTGACTTG
GGTAAGGTCTACTAACTTCTAATCTCTGGATCACTTAACTTAAAATTAGCCTATCTTTTG
ATCGAAAATGCTGTAAGTCTAGCAATGTAAAACGATAATCTGCTTCCTAGATGCCATGAA
CTCTTGAACTTAATTAAGACTCATCATGAAAATGATTACAATTAAGCACTGTTATTCATA
TTGAAGTAGTCTAAAGAATCAAAAGATAAAATCATTAGAGTGATCTCTGGAGAGTCAGGC
AACAGCAATTTGATTGCCTAATTCGGAGAGAAGGAATATTCTTTGTTAAGTGCTCTTGGT
TCACAACACAAAATTACGAAAGTTAATGCTTTATAATCGGTAGTAGAAAACATAAATAAG
CTTACTCAAAATGAGAAAGATTTGATTATCCTTCAATTAGTTACTATCATATAATCTGCA
AGTGATGAAGAAAACATTTTGGAATAAGTATTGAGTGTTTATGATAAAGTTGTCCATCAA
AACCATAACAAAGATAAGCAAGCTTTTGACTTCGAATTTGAAACACTCCACACCTTCCTT
GATTTCAATCTCTAAAACAAAAGATATTCAATAAAAATAAATGAAAAGCTTACAACTATG
TTACTGAAGCTGAATCCTCAGGCCATAATAAATTAACAACTGAAAATGATACTCCTTTTA
AATCAAGATAAAATTACTAATGCTAATATTGTACCACAAATGTTCAGGGATATTCTTAAA
TCTCAGAAGTAACAAATCACTAGAGAGGAGTTAATATAAAGTTTAGTAAATGCCAACAAA
AATACTGAGGTCAAAGATTTGGTATTGTTTGCACTCTCAAATCACAAGCAATTCAAGTAA
TTTCATCATATCGAAAAGTTTGTAAGTTTGTACCTCTAAAAAGTAGAATACTCTGTTGAA
TTAATAAAATCGCTACTTTAAACACTAAAAACAAGTTTATCAAGCTTAAGTGTTAATTTC
TTAACTCAGTTCTTGTAAACTATTCTTACAAAATTACCAAATGATGTAATTTAAACTGCT
CCAAAGATCTTCTCAAAAATATTAGGATTAGCCTTGAATTTGAAGCAAAAGGATCTGACT
TATAACATGAACTAAATCATCTCTCACTTGATAACAAATTTCTTGAACAATTAAATCCAG
AGATACGTCGAATATCTCATCCAACTCTGCCTGGAAACCAAGAATGACCTCAAGAAAATG
TTCTGCCTCACAAATCTCTCTCAGTTATCAAAACTAAGACAAATTGAGCCAGCTTTTATG
GTGATTACAGCTCTAGTGTGTATGAATGATTAATCTCAACTTGTTAGATCAGGTGCATTC
AATCTTGCAAGTATCTTGATAAGCTAAGGTGAAAGCCTGGAATTGTTGGAGATATTTAAA
AATACACCTAAACCAAGATCAGCAAAGAAATCATTTTCAGATAAACAAGCTTTTACTCCA
ATGAAGCAAAAACCAATGAAGTCTATATTGAAGGATTTAATTTAGATGAAAACAGAAATT
TTAACTGATAGGTCATAATTAAGTGTTGGACTCAATAATAGCCCACATGTTAAGTTGATA
GACTAAGTCGTCAGATCAATGATTGATTTACCAAGTATCAAAGTCAAGAGCAAGTTTGTT
GAAGTATTGTCTCTCTTGAACAACTTCTCTGTAATTTTCTCAATGGGTCTCCAAGAACAA
TTGAATAAAGAATTCTTAATGATAAACTAAAATAAGCTTTCTCAAGACTCACAAGATTAT
CTTTACTAAGTAGGACAGCTAATTCAACAAGTATGCAGAAGACAAACTCATGAGACCATT
GAAGAGCATATATCCTCATTAGTATTCCCCTATATCAGCTTAATTTTCACTTTGAGTGAG
AAGAAAGTACAATACAATTACAAACATGAAGAGCTCCTGCAAAATTTATTCACTAAAATC
ATTATAAAGGAGGATTTACTGCAAGTTAAACCTTAAAACATATCAGAGCTGCTTAGATAC
TACATTAAATCACAGATTTATATATACTCTAAACTTATTCGTAATCAGATTAAGGAGTCA
TTCGTTGCATTAAGGGAGGAGTAATTCTCTGATAAGGAAATTAACCCTATTCTTAATGAA
ATTATTGAGAAAATTACAAGCAAGAAAGATGTTGAATCATCATTAGCTAATTATGAGATA
TTGTTAGAACTCATTGCTTAAATCAAGGTCGAGAATGACTATCAGAACCTTCCTTAAATC
CTGAACATAGTGAAGACACTTTCAAATGAAATGAGTTAACAGAACGTATTCTATATCATT
GAACTCTCGAACTAAGTAGCTCTCACCATTTTAGAGAATAAAAAGAATTCCAAGAAGAAC
CTTGGAAAGAACCTAGAAATAATTGTTGGTGTGCTTGATATTCACATCGATAAGTTGAAA
AATGAAATTATTTAGAAAGTAGAAAACTAAGTATCCTAAACTTCTGACCCTTTCAAAGAT
TTCATAATGGAGGTAGATACTTCATCTAAATAAGACTAGAAAAAAGAAGAGCTATAAACT
GAAGAGTTCACTGGTTCATTCCAAATTATCTCAAGTATATTGAACTTACTGTCCTAATAT
GAGATAATCATAAGAACTAACTTGACAATTACCTTCTAGATATTTGATAAATTAAGCTCT
TTAGTCTAATTTTTGACAAGGCATGAGAAATCTTCCTCTGCAGTAGCAACCAGCTTAATA
TTCCAACTATTCAGATTTTATCACAATTAAGTTGTAAGAACTTGCAAGAACAGTCAGAAG
AAGCAGTAAGATTTAAAGTTATTACTGGCTTAATATATTGATACTCTATTGATGCTTTAA
GATTTTGTCTCAGACACAACCCAATTGTTCGGTTATTTAGAGAAAGTTAGCTTCACTCTA
GAAAATCAATATTCTACATTCATAATTACCATTTTGCTATGTCATGCTAAAGATCAAATT
CAAGTGAAAGATAACATCTAAATTGACAGTCTAGAAATCCAATTAATATAGAGACTCATC
CTTTAAACTTTGACTCCACTCCAGAGCTTGCAAGTCCTCGAGGAACTTCTATTCACAGTT
TCTGTCTTTAAAATATCTGAAACATCAAATGACTTCATTAAGACAAAGCTTAAACTTGTA
TTTAATCAGGATCTTGTGACTAAAAGAATGGATGAAGCATCTTGGTCTCAAAATAGATAT
CTCATTACATCTGATTAAGAAGTTAGAAAGTTCAAGTATCTCTCTGTGTTTTTAATAAAC
TCTTGGATTTCACAAAATTAACAATACTAGAAACATCTGTCTCTTACTCTCCATTAAGAC
AACAAGGAATTAAAGTAGACATATCAAGTATTTTATCAAATTTATCTGACTTCATCAATT
TTCAATGAGTAAATAAATCACCTCTTACAAACTAAAGATTATGCTTCTGATAAGAAGGCA
AAGAAATCCCTAAAGAGACTTAGCTCAAGAGTCTAAGAATTCCAAAAGAATTTAAATACT
CTTCTCAGTTACGAGGTTCAAATTGATATCGTACTTAGAATTTTAGAGTTCAAGGATAAG
CAAACTACATATCTTAAAACTTAATCCCTTCAACTTTTGATCAGCAAAACTCCCTAATTT
TCTTAAGGATTATCAAAAGTCTAAGAGAGAGACTTGATTCATTCCTTCACTCCTTTAATT
TTGAAATCAATCAAAATCCTTTAGGAATTTGAAGCAGGCTCATAAAAATTCAATAATGAA
AAATAGAACTTTATTCATGCCTTATTCTGCTTAATTACTAGAACTTTTACAAGTTAGTTA
TCTATAGAAATGAAGTAGTAGATATTGGATCTTAGTTTCTAATACATCTCACTTAGCGAG
CAGTTTTCCATGATTTTGACTTCCCAACTTATTTTAACTCTTATGACAGTATTTGAAGTA
CAGCAGTTAGATATCTTGGAGCATTTACCAAGATTCATCACCCACTTAATCAGATCTTTC
CAAAGATTACACATTGAGGGAACTGACTAGGAATTCTTTGAAGAGTCTTACTCTAAAACA
CTTCTCAAAGCCACTCTTTCGTTGATTACTTTCTTCTCTAAGTTCCTAACAGCAACTTAA
TATGAGGAATTAATTATTAATGTATTAGTTGTTGCATCAACTGAGCATAATCAGGAAGTA
ATCCAAATCTTCGATTTAATAGCCAAAGAATCCTCTAAAAACATTCAATTTAAACTTATT
TTCCAGGCAATGATAAACAGTTATGAAACTGTGATAATTTAAGGAGGTGTGATTGAAAAT
AAATACAAGAATAACTTGAACATTATAATTATCAGATTCTTTAATGATTTAATGAAGCCA
ATTGTTATGAGAATGAAGAAAGACTTCTGCCAAGAAAATCACAATAAGATCTACTTGTTC
TTCAAGGATGCCTTTGAATTGACATTAAATTACTACAGAAACAATAATAAGTAAGAGCTT
AGTGGATTTGGTAACATTGAATAAGCAATTGCTGAGTCATTCGAACAGTTTGTTGTAAAA
CTAAATGAAGACCAATTGAGACCAATTATTGTGAAACTCTCTAAATGGGCTTTTAAGACT
ATAAATGACGCTGATCAAGCAGTTCCTTTTAACATCTTTAAAACCACTGTATTCTACAGA
TGCTTAAACACAGTATTAAACACAATTAAAGAATTCTTCGTGCCACTTCTCCCACTCTAT
TTCGAGAGAACCCTAGAACTATTAATTTCACTTGCTTCTTAACAATAAGCTACTGGTAAG
AAGAGAGGTAGAATCCAAGTTGACTTTGAAGTTGAGTTAGGCCACTAACAACACACACTA
TTCGACTTGATGAAGCTTGCTTGTGAAAATATAAGACTGAATTTCTTGTATGACAACTTA
GCTTTTATTCAAAACGATTCCTTCGAAAAACTCTCAGACCCACTCTCCAATTTAGTTGCT
CTCGAACAACTTGGCAAGCACTATTTACCATTTATTGAGGATACTTTGAAACCTACTATC
TTTGAGGCTGTTGAAAGAATCAATAATGATGACATGTGGAAGAAGATTAACAATGAGCTT
TTGATGCATACTAGAAACACCAACCCAACTGTGAGACTAGGTGCATTCCGTGTAATTGAA
AATCTTTACACAAAGATTGGCGAGAGATATCTCGTGCTCCTTAATGATACTATACAATTC
TTGTCAGAGGGTATGGAAGATGAAAACCCAGATGTAGAAGCTACTGCTAGATCCATAGTA
CAAAGAATTGAGTCCATTACTGGTGATAGTATCCACGAATACTTAAAGTGA


>Contig271.1.g43(protein)
MIQVVNLKQDDYFQFLEQFAFKGQALDKNILIKSLARNDAIVFSKYSQFCFDLADFHQEI
SASLISVESCLHWKFFGTMLSEVLKSQAGQSQTSLFNLLPFISKAMKSEIKDFKISSYMA
ISQISCRRSLSTEYASAFFKQVLLSLKDQQNEEYIEKGILVISLIIQYQNIKMIDEKDVN
QFLQIFRVQKLIKRMADQQDLSSLLKTIMTSTLVQTTIDLGKVYQLLISGSLNLKLAYLL
IENAVSLAMQNDNLLPRCHELLNLIKTHHENDYNQALLFILKQSKESKDKIIRVISGESG
NSNLIAQFGEKEYSLLSALGSQHKITKVNALQSVVENINKLTQNEKDLIILQLVTIIQSA
SDEENILEQVLSVYDKVVHQNHNKDKQAFDFEFETLHTFLDFNLQNKRYSIKINEKLTTM
LLKLNPQAIINQQLKMILLLNQDKITNANIVPQMFRDILKSQKQQITREELIQSLVNANK
NTEVKDLVLFALSNHKQFKQFHHIEKFVSLYLQKVEYSVELIKSLLQTLKTSLSSLSVNF
LTQFLQTILTKLPNDVIQTAPKIFSKILGLALNLKQKDLTYNMNQIISHLITNFLNNQIQ
RYVEYLIQLCLETKNDLKKMFCLTNLSQLSKLRQIEPAFMVITALVCMNDQSQLVRSGAF
NLASILISQGESLELLEIFKNTPKPRSAKKSFSDKQAFTPMKQKPMKSILKDLIQMKTEI
LTDRSQLSVGLNNSPHVKLIDQVVRSMIDLPSIKVKSKFVEVLSLLNNFSVIFSMGLQEQ
LNKEFLMINQNKLSQDSQDYLYQVGQLIQQVCRRQTHETIEEHISSLVFPYISLIFTLSE
KKVQYNYKHEELLQNLFTKIIIKEDLLQVKPQNISELLRYYIKSQIYIYSKLIRNQIKES
FVALREEQFSDKEINPILNEIIEKITSKKDVESSLANYEILLELIAQIKVENDYQNLPQI
LNIVKTLSNEMSQQNVFYIIELSNQVALTILENKKNSKKNLGKNLEIIVGVLDIHIDKLK
NEIIQKVENQVSQTSDPFKDFIMEVDTSSKQDQKKEELQTEEFTGSFQIISSILNLLSQY
EIIIRTNLTITFQIFDKLSSLVQFLTRHEKSSSAVATSLIFQLFRFYHNQVVRTCKNSQK
KQQDLKLLLAQYIDTLLMLQDFVSDTTQLFGYLEKVSFTLENQYSTFIITILLCHAKDQI
QVKDNIQIDSLEIQLIQRLILQTLTPLQSLQVLEELLFTVSVFKISETSNDFIKTKLKLV
FNQDLVTKRMDEASWSQNRYLITSDQEVRKFKYLSVFLINSWISQNQQYQKHLSLTLHQD
NKELKQTYQVFYQIYLTSSIFNEQINHLLQTKDYASDKKAKKSLKRLSSRVQEFQKNLNT
LLSYEVQIDIVLRILEFKDKQTTYLKTQSLQLLISKTPQFSQGLSKVQERDLIHSFTPLI
LKSIKILQEFEAGSQKFNNEKQNFIHALFCLITRTFTSQLSIEMKQQILDLSFQYISLSE
QFSMILTSQLILTLMTVFEVQQLDILEHLPRFITHLIRSFQRLHIEGTDQEFFEESYSKT
LLKATLSLITFFSKFLTATQYEELIINVLVVASTEHNQEVIQIFDLIAKESSKNIQFKLI
FQAMINSYETVIIQGGVIENKYKNNLNIIIIRFFNDLMKPIVMRMKKDFCQENHNKIYLF
FKDAFELTLNYYRNNNKQELSGFGNIEQAIAESFEQFVVKLNEDQLRPIIVKLSKWAFKT
INDADQAVPFNIFKTTVFYRCLNTVLNTIKEFFVPLLPLYFERTLELLISLASQQQATGK
KRGRIQVDFEVELGHQQHTLFDLMKLACENIRLNFLYDNLAFIQNDSFEKLSDPLSNLVA
LEQLGKHYLPFIEDTLKPTIFEAVERINNDDMWKKINNELLMHTRNTNPTVRLGAFRVIE
NLYTKIGERYLVLLNDTIQFLSEGMEDENPDVEATARSIVQRIESITGDSIHEYLK