Identifiers and Description

Gene Model Identifier

Contig7344.0.g48

Standard Name

HDP1

Aliases

Contig7344_0_g48

Description

Herpesviridae UL52/UL70 DNA primase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03121 ) Herpesviridae UL52/UL70 DNA primase

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7344.0.g48(coding)
ATGTTTGCTTCTTTTGGATTTCAACATTTTAATAATTCTTCATTCTTATGTTTAGACATC
AATCATAAAAATGGTAGAACAATGTTCTTAAGTTTAAACAGTACCAAGTTCCAGCTAGAA
TAACTCTGGATTTTAAAACACTTTATAATAGATAAATGCTTTGATAGCACTCCAGTCAGT
CGTATCAAATTCATAAAAATTAAATTACAAAAGATCAAATCAAAAAAAGCTACTTCAGAA
GATGTAAACCACCAGCTATCTAACACATAAACAAGCTATAGACCTGAATTTTTATAACTC
ATAATTGATGTTGAAGGTGGGCTTTTTCTTGAAGCCTACGACTCTCCAGAGGGAGGAAAT
CCAACCATAGCAGTAGGCCATAAACTACAAGACAATGAGCTTTCAATGTTGAGCGTATCA
GTTTAGTAAGGAATCAGACTTTTTATTGAAGATGTTGAAAAGGCAGAGAAAGCAGTGATT
AACTTTGTATAATCAAAAGGCATAGACTACGCTAGTCTCTCACATAATTAAAAAGAGCTA
CTCATCGACTTCTCATTCAATTTAGGGCCAACTTTCCATTAAAAATTTCCAAATTTCGTT
AGAGGCGTATTGACTAACGATCACAAGCTAATGAATGAAAATTATCGAAGAATGTATAGA
GGGATAGGCAAGGATGGTGTTTCACAATTATTACCCCTAAAAGACAGAAACAAAAAGATT
GCCATTTAATATGGATTTACAATTCATCCAGATGACATGTGA


>Contig7344.0.g48(protein)
MFASFGFQHFNNSSFLCLDINHKNGRTMFLSLNSTKFQLEQLWILKHFIIDKCFDSTPVS
RIKFIKIKLQKIKSKKATSEDVNHQLSNTQTSYRPEFLQLIIDVEGGLFLEAYDSPEGGN
PTIAVGHKLQDNELSMLSVSVQQGIRLFIEDVEKAEKAVINFVQSKGIDYASLSHNQKEL
LIDFSFNLGPTFHQKFPNFVRGVLTNDHKLMNENYRRMYRGIGKDGVSQLLPLKDRNKKI
AIQYGFTIHPDDM