Identifiers and Description

Gene Model Identifier

Contig14083.0.g74

Standard Name

HDAC1c

Aliases

Contig14083_0_g74

Description

Histone deacetylase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL330C1.0001788721085356e-149RPD3 SGDID:S000005274, Chr XIV
from 19302-18001, Genome...
T. thermophilaTTHERM_005026101.9998298245723724e-130Histone deacetylase family pro
tein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14083.0.g74(coding)
ATGAAGCCTTTCAGAATCAAGATGACCCATCAACTAGTCCTGGCTTATGGTCTCTACAGA
AAGATGTCAGTCTATTAACCACACAAAGCCACAGATTAGGAGATGATAGCATTTCACTCA
CAAGACTACATCGAGCATTTGAAGAGAGCCGCACCAAATCTTTTGAATAATAACTTTGAA
ATGAAATTCAATGTTGGCGAGAATGACTGTCCTTGCTTCCCTGGTTTGTATGAGTTTTCC
TCGATTTCTGCGGGAGGATCTCTTGATGCTGCTATCAAACTCAATCACAAAAGTGCTGAC
ATCTGTATCAATTGGGCTGGTGGTTTACATCATGCAAAGAAAATGGAGGCCAGTGGATTT
TGCTATGTAAATGACATTGTATTGGGAATTTTGGAGCTTTTGAAGTATCACAACCGTGTG
CTCTACATTGACATCGATGTTCATCATGGAGACGGAGTAGAGGAGGCTTTCTACTGCACA
AACAGAGTGATGACAGTGTCTTTCCACAGATATGGAGACTTCTTCCCTGGTACTGGAGAC
ATCAAAGACATTGGCTATGGAAATGGACAGTACTACGCCTTGAATGTGCCACTTAATTCT
GGAATTGATGATGATAGCTATTTCAACTTGTTCAAGACCATCATTGAAGAAGTCAGATAG
AGGTTCAGGCCTGATGCTGTTGTGATCTAGTGTGGAGCTGATTCGCTGGCTTATGATAGA
TTAGGAACTTACAATACTACTTTGAGAGGTCATGGTGAGTGTGTCAAACACATTAAATCT
TGGGGCATACCTATGATGGTAGTTGGTGGAGGAGGCTACACTATTAAAAATGTAGCTAGA
TGCTGGGCCTATGAAACTGGTATATGTCTAGGACTGGATCTTGACAACCAAATACCCATG
AATGATTTCTATGAGTTCTATGGAAACGACTACAAACTTCATTTCAACCCTAAACCAGAT
GAGCCAAATTTGAACTCAAAGGAATACTTGGACTTTGTACAGACTAAATGCCTTCAGAAT
TTGAAAACTTTGGAGGGTGCTCCCAGTGTCGGTATCCTAGATTACGTTCCCACAGATTTC
TTCACACATGATATTGTTGAGTCCATGCAGTCTAGCAAAGTAGAGCACAGTGGAAGACCT
TTCTGA


>Contig14083.0.g74(protein)
MKPFRIKMTHQLVLAYGLYRKMSVYQPHKATDQEMIAFHSQDYIEHLKRAAPNLLNNNFE
MKFNVGENDCPCFPGLYEFSSISAGGSLDAAIKLNHKSADICINWAGGLHHAKKMEASGF
CYVNDIVLGILELLKYHNRVLYIDIDVHHGDGVEEAFYCTNRVMTVSFHRYGDFFPGTGD
IKDIGYGNGQYYALNVPLNSGIDDDSYFNLFKTIIEEVRQRFRPDAVVIQCGADSLAYDR
LGTYNTTLRGHGECVKHIKSWGIPMMVVGGGGYTIKNVARCWAYETGICLGLDLDNQIPM
NDFYEFYGNDYKLHFNPKPDEPNLNSKEYLDFVQTKCLQNLKTLEGAPSVGILDYVPTDF
FTHDIVESMQSSKVEHSGRPF