Identifiers and Description

Gene Model Identifier

Contig4139.0.g38

Standard Name

HDAC1a

Aliases

Contig4139_0_g38

Description

Histone deacetylase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006473303.0009023271667765e-140Histone deacetylase family pro
tein
SGDYNL330C9.995727384924316e-137RPD3 SGDID:S000005274, Chr XIV
from 19302-18001, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4139.0.g38(coding)
ATGAAGCCTTTCCGTGTCCGCATGACTGATGAAATGATACGCTCTTATGGCATGGACAAA
TAAATGAAGAGAATGGAAGTGGAGCCTGAATTTATTGAAAATGTAGACTTCACTGTATAT
CATTCTGATGATTATGTAGATGTCCTCAAGAATCTTACTCTTGACAACAGAGACCTCTAC
GCTGATTAGATAAATAGATTTAACTTTGGTGAGGACTGCCCAATATTTGATGGAATGTAT
GACTATTGCTAGATTTATACTGCAGGGAGTTTAAGAGCTGCATCATGGGTGGCTTAGGGA
AACTCAGATATTGGCATTAACTGGGCTGGAGGACTCCATCATGCTAAGAAAATGGAAGCT
TCAGGTTTCTGCTATGTCAACGATTGTGTTATGGCAATATTGGAATTCCTAAAAACCTAT
GAGAGAGTCTTATATATCGATATTGACTGTCATCATGGTGATGGAGTAGAAGAAGCTTTC
TTTACAACAAATAGAGTTATGACTGCATCATTCCATAAGTTCGGAGATTATTTCCCAGGG
ACTGGAGCAATTGATGACATTGGTGCTGGGCCTGGAAAGCATTACTCAATGAACTTTCCT
TTGAGTGAAGGAGTTGATGATTTTACTTTCGAATAAGCTTTCAAGCCAGTTATGAAGGAA
ATCATGGATAGATTTAAGCCTTAGGCAATTGTCCACTAGTGCGGAACAGACTCACTTTCA
GGTGACAGACTGGGTCTCTTCAATCTCTCAGTTAAAGGCCATGGTGCGACAGTCGAATAT
ATGAGATCTTTTGGAATACCTATGATTCTTGTTGGAGGTGGAGGCTATTCTCTCAGAAAT
GTTGCAAGATGCTGGACTTACGAAACCTCGGTAGCCCTAGGCATAGAAATCGATAACAAT
ATACCTCATCATGAGTATTCAAGCTATTTCCAACCAGACAGCAAGATTGTTGTACCAGTG
AGCAATATGGAGAATAATAACTCAAGAGAGTCAATTGAGAAATCTACTCAAGAAATCCTT
TAGAATTTAAAGAACGTTTAAGCTGTCAATGTAGATCATTCTTATTACAGGAACTAGTAG
GGACATGCTCCACATCACTTGGCCTTTGATGAGAGTGAAAACAGACAAATTAAAGAAGAT
AAGAATAAAGATACTACACCAGACAACTAATGA


>Contig4139.0.g38(protein)
MKPFRVRMTDEMIRSYGMDKQMKRMEVEPEFIENVDFTVYHSDDYVDVLKNLTLDNRDLY
ADQINRFNFGEDCPIFDGMYDYCQIYTAGSLRAASWVAQGNSDIGINWAGGLHHAKKMEA
SGFCYVNDCVMAILEFLKTYERVLYIDIDCHHGDGVEEAFFTTNRVMTASFHKFGDYFPG
TGAIDDIGAGPGKHYSMNFPLSEGVDDFTFEQAFKPVMKEIMDRFKPQAIVHQCGTDSLS
GDRLGLFNLSVKGHGATVEYMRSFGIPMILVGGGGYSLRNVARCWTYETSVALGIEIDNN
IPHHEYSSYFQPDSKIVVPVSNMENNNSRESIEKSTQEILQNLKNVQAVNVDHSYYRNQQ
GHAPHHLAFDESENRQIKEDKNKDTTPDNQ