Identifiers and Description

Gene Model Identifier

Contig18994.0.g68

Standard Name

HATA

Aliases

Contig18994_0_g68

Description

Bromodomain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002483901.9991070409258158e-114histone acetyltransferase gcn5
SGDYGR252W7.003377498796081e-81GCN5 SGDID:S000003484, Chr VII
from 996869-998188, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18994.0.g68(coding)
ATGATTGATACCTCTACGGCAATTGTTAATGAATCAAATCTCTCCCAAACCACTGCCAAA
TTCCAATACGAGGAATAGAAAGGAGATTCTTAAATCGAAACTAGATTAGTTGGAGAGACT
GGTCTTGGTTTTGTAAGAAGAGATCTAGGTGTGAAAAATGAAGAGGAACAAGGATTGCTC
AAATTTATAGTCATAAAGAACGATAAATCAATAGAGAGCATGAGACACTTAATTGACTTG
AAGAACATTATAGCTAAATAATTGCCAAAAATGCCCAGAAACTACATAGTCAAGCTCATG
ATGGATCGTTAGCATGAAGCCATGGTTATAATGAGACACCAAGCAGGAAAACGACCTCAA
ATTATAGGAGGTTGTGTATTCAGGCCTTTTAGATCTCAAAGATTTGCAGAGATTGTTTTC
CTTGCAATTATGACTTCTGAATAGGTGAAGGGACTGGGTACAAGACTAATGAATAAGCTT
AAATCGCATGCTTAAAAAGAGGGCCTTCAATATTTCCTAACTTATGCTGACAATTTAGCC
ATCGAATTTTTCAAGAAACAAGGCTTTAATCAGAAAGGCTATATGGCAGAACCAAGATGG
AAAGGCTATATAAAGGATTATAGTGGAAGTACAATGATGCAGTGCTAGATACATACTGAC
ATTGATTATGTCAATTTATCTGATGCACTCAGACTTCAGAAAGATGCAATAATTGAGAAA
ATTAAGAGCATTATATCTTAAAAAGTTCAAGAAGGACTTAACTTCGAAAATGGCTAAAAA
GCTTATGAGTTTGAAAATATTCCAGGACTTATAGAAGCTGGTTGGAATAAAGAGGCATAT
GAAGTAGCAAAGGCTGGTGAAGAGAGAACTTTCTAAGAATAGTGCCAGAAAATTTTGAAG
TTCTTGCTTGATCACGAATCTTCTAGAGTTTTTAGAAAGCCAGTAGATCCCAAGAAAGTG
CCAGATTATCATCAAATCATTAGAGAGCCTATGGATTTGGAGAAAATTTAAAAGAATCTA
AACGAATCTCTTTATCATACAGTAGACCAATTCAAGAAAGATTTGATTAAGATTTTCGAT
AATGCTCGTTAATACAACAATCCAGAGACAATCTATTACAAGTACGCTAATTAGCTTTAA
GCCCTGGTAAAGCCAATGCTCGATCGTATGAGAGAGAATAACTCCTTCGAAAAAGATATT
AAAATGCTATAAAATGTTACAGGATAGCAATCCTTACAAGTAAACAGCTAAAGCATGGGA
GATGTCAATATGGAATCTTACGATTAAGGAGACAATAGCAGCAACGTACCCGAAAACCCC
AGTGTTCATGGAAGTGCCATGCAAGAAGGCAAGAGAAGAAGCGCTATAGACAGTAAAACT
AGAAAAATGAAGAGATGA


>Contig18994.0.g68(protein)
MIDTSTAIVNESNLSQTTAKFQYEEQKGDSQIETRLVGETGLGFVRRDLGVKNEEEQGLL
KFIVIKNDKSIESMRHLIDLKNIIAKQLPKMPRNYIVKLMMDRQHEAMVIMRHQAGKRPQ
IIGGCVFRPFRSQRFAEIVFLAIMTSEQVKGLGTRLMNKLKSHAQKEGLQYFLTYADNLA
IEFFKKQGFNQKGYMAEPRWKGYIKDYSGSTMMQCQIHTDIDYVNLSDALRLQKDAIIEK
IKSIISQKVQEGLNFENGQKAYEFENIPGLIEAGWNKEAYEVAKAGEERTFQEQCQKILK
FLLDHESSRVFRKPVDPKKVPDYHQIIREPMDLEKIQKNLNESLYHTVDQFKKDLIKIFD
NARQYNNPETIYYKYANQLQALVKPMLDRMRENNSFEKDIKMLQNVTGQQSLQVNSQSMG
DVNMESYDQGDNSSNVPENPSVHGSAMQEGKRRSAIDSKTRKMKR