Identifiers and Description

Gene Model Identifier

Contig7568.0.g97

Standard Name

HAT1b

Aliases

Contig7568_0_g97

Description

Histone acetyl transferase HAT1 N-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam10394 ) Histone acetyl transferase HAT1 N-terminus
  • ( pfam05301 ) Touch receptor neuron protein Mec-17
  • ( pfam00583 ) Acetyltransferase (GNAT) family
  • ( pfam13508 ) Acetyltransferase (GNAT) domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000467605.998760051700188e-30hypothetical protein
SGDYPL001W9.998720540547892e-23HAT1 SGDID:S000005922, Chr XVI
from 554605-555729, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7568.0.g97(coding)
ATGTCTTAAAGATACTACAAGAAGGAGGCTAAAATTGCTTAACCTACCAAGAAAAGAGAA
GCAAAATCTGTTTAAAAATTGAATTCTAAGGCTGAATATTCTAAAAAAATTGAGTAGCCA
TCTCCAGAGAAAAGTTAACTAGGGTCAGCTACTAAAAAGCGTAGATGGATTCAGGAATTT
ACAGTGAAACATGGCCCTACAAACTTGAAAAGAAGGAGGATTTTCGTGGATTTGATTGAA
CTCTAACACTATAGTGGAATGGCTCTATTTAAAAATGAACTTGACATGTTAAGTGACAAA
GAGCCCTTTTTTCACCCTAAATTTTCTCATTAGATATTTCACAAAGATGAGACAGTTAGG
GGTTTTAAAAATCTTACAATTGACATTTTTCTTACTCCTGCAACTTTGAGACCTTTTTTG
AATGTAAACTTCGAAAAATAAGCTAAAAATCACGACGAAATTGAATCTACATTGTCAAAA
CATTTCGGTGAGGATGGATTAATAAAAACAAGAAAATAATTCTTGGACGCAGTAAAGGAT
GAAGAGACAAAGTTTAAACCATTAGGCAAAAAGGTTGGCTCTTTCATAAGACAAATGCCA
ATATAAGATAATGATTTACTAAATCTAATGGACAAAAAAGAGAAAAGATCAAGTTCAAAA
ATGAAATAACAGCTTGAAAATGTTTAATTTGATATCTACAAAATAGAAGCGGATCATAAT
AAATTTTCTGAAATCAACAGAAGATTGCAAGCTATGCTAATATTTTACATAGATGGAGCT
TCTTTCATTTCAGTTGATAAAGACTGGTCGTACTTTCTAGTCTACCAAGGCCCTAATCTT
GTAGCTTATTCTACTGTCTATGAGTAAAAAAGACCTTTGAACATGGGCAAGAGCAAGGAG
CTCTAAAAGAATCCATGCAAAACTATAAGATAAAAAGAGATTCAGAAAACTCTATCTGCT
ACTAAATACACTTACAAGCTAAGAATCTCATAGTTTTTAGTTTTGCCGCCTTATTAAAGA
CTCGGTGTTGGAAGTGTGTTGCTCGAGCAAATGTATAACTTTTATCTCGTTGACAAAAAA
TGTGTTGAGATCACAGTTGAAGACCCCTCTCACGATTTCTAAATCATGAAAGATGCTCTC
GATATAAAGCTCATTTGGAAAAATGGATTCTTTGAAGCTTTTAGAAATATGTTTAAAGGC
AAAAATTCATTGAAGTCATCAAACATTAACAAATTCAACTTCGATTAACTTGTTCTTGAT
CAACAAGAAATTTCTAACATTCAATCTCTCTTGAAGTTAAAGAAATAAAACATTTTGAGG
TGCTTTGAACTCTTGATACTTGCAAAGCTTGATACCAAGGATCCAGTAGTACACTAAAAA
TTTGCTTAAGAAGTAAAAAGAAAGTTTTATTACTAAATGAACAAGAACTTACTTCAACCA
TATTTCTAGCTTGAGAACTTTTACGGAAACATTATATCGAGTAGCCAATAGACACATGAG
GAACTTAATCCAGTAAAGAAAGAGCAGATTAAGTGCTGTGACGGTTTTGGCAAAGTTATC
ACAGATGAGCAGTTTGAAAATTTCGAACAATCCTTAAGCAAAAACAGACATCATTTTTAC
AATGAAGGGGGAAACAACGATCAAGAAAATCACAAAGAATCTTAATCAGCAACAAGACAT
CACGTGCTAGAATATCAAAGAAGTTACAATAAGTTTACTCCTACACCAATGCCTCAAATT
GGACTCATAAATGGATTTGCAGCAAGTCAGCACTATGGTGGTGGCAATGGTTATAATCAA
TTAGTAGCCACGAAATTTGAACTTCCAGATGGCCTAAGACAGAAAATACTCAAGATCATA
AGCAGTGATTGA


>Contig7568.0.g97(protein)
MSQRYYKKEAKIAQPTKKREAKSVQKLNSKAEYSKKIEQPSPEKSQLGSATKKRRWIQEF
TVKHGPTNLKRRRIFVDLIELQHYSGMALFKNELDMLSDKEPFFHPKFSHQIFHKDETVR
GFKNLTIDIFLTPATLRPFLNVNFEKQAKNHDEIESTLSKHFGEDGLIKTRKQFLDAVKD
EETKFKPLGKKVGSFIRQMPIQDNDLLNLMDKKEKRSSSKMKQQLENVQFDIYKIEADHN
KFSEINRRLQAMLIFYIDGASFISVDKDWSYFLVYQGPNLVAYSTVYEQKRPLNMGKSKE
LQKNPCKTIRQKEIQKTLSATKYTYKLRISQFLVLPPYQRLGVGSVLLEQMYNFYLVDKK
CVEITVEDPSHDFQIMKDALDIKLIWKNGFFEAFRNMFKGKNSLKSSNINKFNFDQLVLD
QQEISNIQSLLKLKKQNILRCFELLILAKLDTKDPVVHQKFAQEVKRKFYYQMNKNLLQP
YFQLENFYGNIISSSQQTHEELNPVKKEQIKCCDGFGKVITDEQFENFEQSLSKNRHHFY
NEGGNNDQENHKESQSATRHHVLEYQRSYNKFTPTPMPQIGLINGFAASQHYGGGNGYNQ
LVATKFELPDGLRQKILKIISSD