Identifiers and Description

Gene Model Identifier

Contig10852.0.g20

Standard Name

HAT1a

Aliases

Contig10852_0_g20

Description

Histone acetyl transferase HAT1 N-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000467605.999781043483669e-32hypothetical protein
SGDYPL001W1.9994498063102785e-22HAT1 SGDID:S000005922, Chr XVI
from 554605-555729, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10852.0.g20(coding)
ATGAAAAGAACTTTTGGCGAGATCTCAAACTCAAATTTAGCTGATGATAAGCAATTGCAT
ATCTATGGCAATGAAACCAAGAGAAGAAAGTTACAAGCCCAACGTATTGGAGACTTTATT
GTAGATGCTAGATAAGCAATAAATTTTAGACTCAGTTCTGATATCAACAAGCTTGAAGAC
TTATAGGCAACTACTTTGTTTTTCAGTCCCTAATTTGTTCATTTTGTATTTGGTAAAGAT
GAAAGAATCAGTGGATATGAGGGTTTAAGCATTGATATCACTCTTTCAAAGAAAAAGTTA
ATGCCTTTCGTTTAATTCACTTATGAGAATAAAGCCCCAGCATTTGCTAATATTGACAAT
ATTAATGATTTACTTTTAAAGCACTATGGCCGCATTTCTGAAAGACCAGAGGATTTTATT
AAAAATCCTCAAAGAAGAAGAAAACTTTCCTCAGTGATTGAACCAAGCCCATTCTGGAAA
TATTTCTTGATATACGAGAAAATTTCCAAGAATCTACTTGCTTTCGCCACAGTATTTGAA
GCTCATCATAGTGTTGACAGTTCAGAGCTAGATTTCTCAGTTTTAGTGCTTCCACCCTAC
TAAAAGCAAGGCGGAAAAATGAAAAGAACTTTTGGCGAGATCTCAAACTCAAATTTAGCT
GATGATAAGCAATTGCATATCTATGGCAATGAAACCAAGAGAAGAAAGTTACAAGCCCAA
CGTATTGGAGACTTTATTGTAGATGCTAGATAAGCAATAAATTTTAGACTCAGTTCTGAT
ATCAACAAGCTTGAAGACTTATAGGCAACTACTTTGTTTTTCAGTCCCTAATTTGTTCAT
TTTGTATTTGGTAAAGATGAAAGAATCAGTGGATATGAGGGTTTAAGCATTGATATCACT
CTTTCAAAGAAAAAGTTAATGCCTTTCGTTTAATTCACTTATGAGAATAAAGCCCCAGCA
TTTGCTAATATTGACAATATTAATGATTTACTTTTAAAGCACTATGGCCGCATTTCTGAA
AGACCAGAGGATTTTATTAAAATCCTCAAAGAAGAAGAAAACTTTGTGCCTTTAGGTGAC
AAGCTAAAGGATATCATTGATGGAGAAAAGGAATATGAAGTTTATAAAGTCAGTCTTGAT
AATGAAGCTTTTCATGAACAAAACTTTTATTTGCAATCAATTCTTCCGTTCTTTATTGAT
GGAGCCTCAGTGATTGAACCAAGCCCATTCTGGAAATATTTCTTGATATACGAGAAAATT
TCCAAGAATCTACTTGCTTTCGCCACAGTATTTGAAGCTCATCATAGTGTTGACAAGTTC
AGAGCTAGAATTTCTCAAGTTTTAGTGCTTCCACCCTACTAAAAGCAAGGTTTAGGTTAG
AAGCTCTACTAGAGTATTTTCGATCATTACAGACTTGATGAGGAGAAATGTTTCTAAGTA
ATTGTAGAGGATGCTGCTGACGACTTCTAAAGATTGCAAGACCATTTAAATGCTAAGGTG
TATCTCAAAGCAAATACTAAGCTAACAGAAACACTCAAGTCGCTTCCAATAAGTAACGTG
ATTTTGAACTAAGATCAACTTAAAAGGTTTACAATTTCTAGAGCTTAGATTCAAGAGTAC
GCTAAATCTTTAAAACTGCCTGAGTAAATTGTTTTAAGGCTTCATGAGCTTGTGCTGTTC
TCTTTCCTTGAGAAAAACGATTCGGCTCAGAGAGCTTTCAGAATTCAAGTAAAGAAGAGA
TACTATGTTAGACTTGTGAAAGATCATATAAAGCTTTTCACAGATACTGACAATCAAATT
CTAGGATCAAGAGAGGGAGGACTGAAAGAACCTTACCTCTTCAATGATTAACTTGAAGAA
AACCCCTTTTTCAGAGATAGGCACGCAGATGAGGAATAAAAGGACAACAAGCAAAAAGAC
GGAGAGAAAATCTTAATTTAAGAGGGCATCAAAATTGAACTTAAAAATATCTATGATGAA
GTTTAGAAGCAGTACTCTGAGCTTAGAGACAGAATTAATGCTTTGATTACTTAGAACAAG
TTAAATTGA


>Contig10852.0.g20(protein)
MKRTFGEISNSNLADDKQLHIYGNETKRRKLQAQRIGDFIVDARQAINFRLSSDINKLED
LQATTLFFSPQFVHFVFGKDERISGYEGLSIDITLSKKKLMPFVQFTYENKAPAFANIDN
INDLLLKHYGRISERPEDFIKNPQRRRKLSSVIEPSPFWKYFLIYEKISKNLLAFATVFE
AHHSVDSSELDFSVLVLPPYQKQGGKMKRTFGEISNSNLADDKQLHIYGNETKRRKLQAQ
RIGDFIVDARQAINFRLSSDINKLEDLQATTLFFSPQFVHFVFGKDERISGYEGLSIDIT
LSKKKLMPFVQFTYENKAPAFANIDNINDLLLKHYGRISERPEDFIKILKEEENFVPLGD
KLKDIIDGEKEYEVYKVSLDNEAFHEQNFYLQSILPFFIDGASVIEPSPFWKYFLIYEKI
SKNLLAFATVFEAHHSVDKFRARISQVLVLPPYQKQGLGQKLYQSIFDHYRLDEEKCFQV
IVEDAADDFQRLQDHLNAKVYLKANTKLTETLKSLPISNVILNQDQLKRFTISRAQIQEY
AKSLKLPEQIVLRLHELVLFSFLEKNDSAQRAFRIQVKKRYYVRLVKDHIKLFTDTDNQI
LGSREGGLKEPYLFNDQLEENPFFRDRHADEEQKDNKQKDGEKILIQEGIKIELKNIYDE
VQKQYSELRDRINALITQNKLN