Identifiers and Description

Gene Model Identifier

Contig9939.0.0.g44

Standard Name

HARS2b

Aliases

Contig9939_0_0_g44

Description

Histidyl-tRNA synthetase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13393 ) Histidyl-tRNA synthetase
  • ( pfam00587 ) tRNA synthetase class II core domain (G, H, P, S and T)
  • ( pfam00152 ) tRNA synthetases class II (D, K and N)
  • ( pfam01409 ) tRNA synthetases class II core domain (F)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007218309.997540506729281e-98histidyl-tRNA synthetase famil
y protein
SGDYPR033C3.0013832822195203e-89HTS1 SGDID:S000006237, Chr XVI
from 639019-637379, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9939.0.0.g44(coding)
ATGTCAAAGTCAAAATAATTAATTGCAAAATGTCCAAAAGGCACAAGGGATATGCTGCCT
AATTAAATGCAAATCAAAGAAGAGGCTCTATCCAATATAAGAAGAATCTTTCAGATTCAT
GGTGCCTCTGAAATAGACACTCCAGTTTTTGAAAGAAGGGAAATTTTGACAGGGCAGTAT
GGAGAAGGTAATAAGCTCGTTTATGATTTAGCGGATTAGGGAGGAGAGGCTTTATCGTTG
AGATATGACTTGACAGTACCCTTCGGTAGATTTATGGCGACACATAATCTTAGCAAGTTA
AAACGATTTCAAATTGGAAAAGTATATCGAAGAGACTAGCCGAATATGTCGTGCGGTAGA
TATAGAGAGTTTTATCAATGTGACTTCGATATAGCAGGCTAATATTCATAACCAATGTTT
GCTGATGCTGAAGTCCTAAAAGTATTCGAAGAGCAGTTAACCTCTTTGAAAATTAATTTC
AAATTCAAGCTTAATGATCGTAGACTTTTAGATCATGCAATAGTAACAAAAGCAAAATGT
TAGCCAGAGTAAGTTGGTACAATATGCGTTTCTCTAGACAAATTAGATAAAGAACCTTGG
GATAAAGTGAAAGAGGAATTGAAATAGAAGAGCTTAAACGATGACTAGATTATCAAAATT
AAAGAATTTATTGATGTTTAACAGGATGATCCTTTTTAAGCAATTGGAGATTTAAAACAT
TTGCTTGGGCATGCTCCTGTTCTAGATGATCTTAAATAACTTGTTGCTTATCTATAAGCA
ATGGAAATTTAAGATAAAATTAAAATCGACCCTTCACTAGCAAGAGGCTTAGATTATTAT
ACTGGCATGATTTTCGAGGCTGTTCTTACAGGAGAGGAAAAAAATCTAGGTATTGGAAGT
ATTGCAGCTGGCGGAAGATATGATAAATTAATTGGTTAATTCTCTAAAAATGACATACCT
TCAGCTGGTGGAAAAAAGGTGTTTGAGCTAGAAAGATCATATTGCAAATAAAGTTGA


>Contig9939.0.0.g44(protein)
MSKSKQLIAKCPKGTRDMLPNQMQIKEEALSNIRRIFQIHGASEIDTPVFERREILTGQY
GEGNKLVYDLADQGGEALSLRYDLTVPFGRFMATHNLSKLKRFQIGKVYRRDQPNMSCGR
YREFYQCDFDIAGQYSQPMFADAEVLKVFEEQLTSLKINFKFKLNDRRLLDHAIVTKAKC
QPEQVGTICVSLDKLDKEPWDKVKEELKQKSLNDDQIIKIKEFIDVQQDDPFQAIGDLKH
LLGHAPVLDDLKQLVAYLQAMEIQDKIKIDPSLARGLDYYTGMIFEAVLTGEEKNLGIGS
IAAGGRYDKLIGQFSKNDIPSAGGKKVFELERSYCKQS