Identifiers and Description

Gene Model Identifier

Contig9747.0.g58

Standard Name

HARS2a

Aliases

Contig9747_0_g58

Description

Histidyl-tRNA synthetase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13393 ) Histidyl-tRNA synthetase
  • ( pfam00587 ) tRNA synthetase class II core domain (G, H, P, S and T)
  • ( pfam03129 ) Anticodon binding domain
  • ( pfam00221 ) Aromatic amino acid lyase
  • ( pfam01409 ) tRNA synthetases class II core domain (F)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007218309.997093137033517e-262histidyl-tRNA synthetase famil
y protein
SGDYPR033C1.0004025422005049e-134HTS1 SGDID:S000006237, Chr XVI
from 639019-637379, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9747.0.g58(coding)
ATGAAAATCGTAGTAGGACACAAAACCCTAAATCTTGAAGAGCTTTTCAATGTTGCTTAT
CTCCCCACTCAAAACGAAGTCGTGGTTGATAATGTCATTTCATGTGAGTTCAATCCACAA
CCACCCCAAGCACCTCAAAACAAAGAGATATAAGCAGTTCCAGAATTATTGCCAGGTTTC
TCTTTGAATCATGATCATGTTCGCGCAATCTTACTTGTCAAATTAGTTCAACTCATTAAG
TTAAAGAAGAATGTTTCCAAGCAGACAATAAACTATTTCGTCACTATTCTGAACGAAAAT
AGAAACTTCTTGGGAGAAGAAGGAAAGAATTTTTTCTAGGCATTATTTGAGCATTCTAGA
GATCAAAATATCTTTTTCAGTGAAAAGGAACTTTTTATTTTACACGCAAAGCCACACATC
TATCAAGCTCTTTTTGCTTTGGAAGTGTATAAACTGCAATAAAACATAAGATTAATCGAT
ACTTCTCTTGCTTATTCACTTGAGACTTTGAATGTGCACTAAGACTACCTGACAGAGTAC
GCTCTTACCGTTGGTAAGCAAACTTAAGGAGTTAATAACTTCAAGAATTCCATTCTTTCT
CTGATTGATAAGTCCAAGTTGGTTGGAACTGCTAATCAACCTGACAAGGCACTTAACTTA
AGTAAAGTCTTCTAATTGCACGGTTCACTTCACGAAAGACTGATTCAACTTGGGTAGGGA
TTAGCCAATGAAATTAATTCAGACTATGGTTCTCTCTTCCAAGAGAAGAAGTATAAGGAA
TTAATTCAAATTGCAAAAGATCAATAACCAGAACAGATAACAATCCTTGCCCAATAAGTA
TCACCTTTGGCTTACTTAACAGAGTAGTTAGTCTATCTTTCACAAACTAGAACTAACCTC
ATGCTAAAACAAAAGGGTGGTGACTAATTAATGCAACAGGAAGAATCTAAATCTTCATAA
GATCAAGATCTAGCTAGAACTTTCGATTTAATTTCTAGACAAACACTCTTAAATGCTTAT
CAATCTGAGTTGTGGTCAGCTTTCTCAAAGAATAAAGACATTGAAGTGGAATTGAAAGCT
AAGGCTGCTCTCGTTGAACAAGCTAAACCTTAAGAAGAAAAGAAAGAAGCTGCAGCAACT
GACAAAAAGCCACAACAAAATCAAAGAGGTGCAGGAGCAGCAAAGAAGAAAGGCAAGGAA
GCAGTAACAACAATCCAATTTGGTGTTGGTACTAGAAAATTCTTCGATTACTTGTTGCAA
ATTGAATTGATCAACTAGTAAGTGTTCGAACATAAATTGAATGTGTTGCAAAATAAGGAG
CTTGACTCAGTTCTCAATGAAGTTCTTGAACAGAGAAATGAGGAGAGAAGAAAACCAAAG
TGCCCCAAGGGAACTAGAGATATGGACCCACTTCAAATGGCTATTAGAGAAAAGGCATTC
ACTATTATCAAGTCAGTGTTTAAGAGACACGGTGCTTGTGAAATTGACACTCCAGTTTTC
GAATTGAAGGAAACACTTATGGGCAAGTATGGAGAAGAATCAAAACTTATCTATGATTTG
GAAGATTAAGGAGGTGAATTACTTTCTCTAAGATACGATTTGACTGTTCCATTCGCTAGA
TTTGTCTCAATGCACAATTTTGAGAAAATAAAGAGATTCCATATTGCTAAAGTTTACAGA
AGAGATAACCCACAAATGAACAAAGGTAGATTCAGAGAATTTTATCAATGCGATTTTGAT
ATTGCTGGTACTTACTCAATTATGATCCCAGATTCCGAAGTAATCAAAGTACTAAGTGAA
ATCTTAGAACAACTTGAAATCGGTGAATTTGTGATTAAGCTTAATCACAGAAAATTCCTC
GACGCCATGGTAGAACTAGCTGGTTGTGAAAAACGTAAATTCAAGGCTATCTGCTCATCA
GTTGATAAGCTGGACAAGGAACCTTGGGAAAAAGTTAGAGAAGAATTGATCATGATGAAG
GGACTTACACCAGAGATGTGTGATAAACTTGAAAAGTTTGTTAAGTTAGTTGGCAAGCCA
ATGGAACTATTACAAAAGTTGAAGGATGAGGGCATCTTTGCTGGACACAGAGAAGGAGAA
GAGACAATTAAAGAGATGGAAACTTTGTTTGAATACTTGCAAGCCATGAACTGCATCGAT
AGAGTATCATTTGATTTCTCACTTGCTAGAGGTCTTGACTATTACACAGGATTGATCTAC
GAAGCAGTATTGACTGACCCAAACAACAGAGTAGGTTCAATCGCTGGAGGTGGTAGATAC
GACGGTCTCGTCGGTATGTTTGCTGGTAAAACCATCCCAGCAGTCGGAGTTTCAATTGGT
ATTGAAAGAGTGTTCGCTATTCTTGAAGAAAAGCTCAAGAAAGAGAACTCAGTCAGATCA
ACTGAGACATAAATCTACATTGCTTAAATTGGTAAGAACTTAGTTGCTGAAAGATTGAGA
ATCTGCTCTGAACTCTGGGCTATTGGCATCAAAGCTGAGACTTCATATTAAGATAACCCA
AACAACCAGAGATAAATGGAATACACTCTACTGAATGGCATCCCACTTATCCTGTTCTTG
GGAGAGAATGAACTCAAGGAGGGAGTTGTCAAGGTTAAGAGTTTAAGTAAGAAAGAAGAG
TATGTCATCAAGAGAGACGAATTATTGCAAGAAATTATTCAGATTGTCAGAGACAATCCA
ATTCTACTACCACAAGATATGCAACCAGCAGGAGGCCAGCAATAAGAAATGCAGCAAAAG
CCAAAGTAAGAAGAAGAAGAAGAAAAGAAGGAATGA


>Contig9747.0.g58(protein)
MKIVVGHKTLNLEELFNVAYLPTQNEVVVDNVISCEFNPQPPQAPQNKEIQAVPELLPGF
SLNHDHVRAILLVKLVQLIKLKKNVSKQTINYFVTILNENRNFLGEEGKNFFQALFEHSR
DQNIFFSEKELFILHAKPHIYQALFALEVYKLQQNIRLIDTSLAYSLETLNVHQDYLTEY
ALTVGKQTQGVNNFKNSILSLIDKSKLVGTANQPDKALNLSKVFQLHGSLHERLIQLGQG
LANEINSDYGSLFQEKKYKELIQIAKDQQPEQITILAQQVSPLAYLTEQLVYLSQTRTNL
MLKQKGGDQLMQQEESKSSQDQDLARTFDLISRQTLLNAYQSELWSAFSKNKDIEVELKA
KAALVEQAKPQEEKKEAAATDKKPQQNQRGAGAAKKKGKEAVTTIQFGVGTRKFFDYLLQ
IELINQQVFEHKLNVLQNKELDSVLNEVLEQRNEERRKPKCPKGTRDMDPLQMAIREKAF
TIIKSVFKRHGACEIDTPVFELKETLMGKYGEESKLIYDLEDQGGELLSLRYDLTVPFAR
FVSMHNFEKIKRFHIAKVYRRDNPQMNKGRFREFYQCDFDIAGTYSIMIPDSEVIKVLSE
ILEQLEIGEFVIKLNHRKFLDAMVELAGCEKRKFKAICSSVDKLDKEPWEKVREELIMMK
GLTPEMCDKLEKFVKLVGKPMELLQKLKDEGIFAGHREGEETIKEMETLFEYLQAMNCID
RVSFDFSLARGLDYYTGLIYEAVLTDPNNRVGSIAGGGRYDGLVGMFAGKTIPAVGVSIG
IERVFAILEEKLKKENSVRSTETQIYIAQIGKNLVAERLRICSELWAIGIKAETSYQDNP
NNQRQMEYTLLNGIPLILFLGENELKEGVVKVKSLSKKEEYVIKRDELLQEIIQIVRDNP
ILLPQDMQPAGGQQQEMQQKPKQEEEEEKKE