Identifiers and Description

Gene Model Identifier

Contig11427.0.g27

Standard Name

HAP3b

Aliases

Contig11427_0_g27

Description

Histone-like transcription factor (CBF/NF-Y) and archaeal histone

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam00808 ) Histone-like transcription factor (CBF/NF-Y) and archaeal histone
  • ( pfam00125 ) Core histone H2A/H2B/H3/H4

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR397C0.000000000010004361180063202NCB2 SGDID:S000002805, Chr IV
from 1266769-1266366,1266...
T. thermophilaTTHERM_002920700.00000000009998509410508463hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11427.0.g27(coding)
ATGGAGTCGACGAACATGAACAATAAACCACAAGGCAAGTATGACCTAACTTTGAGCAAG
TCAAAGTCAATTCCAACAGCGACCAACCCTACCTTCGGCCCAGTTGACAATGAAGAGTAC
ACTCTTCCAAGAGCAACTTTGACACAGTTAATAAAAGAGATGTTGCCAGCTGAGATGCGT
ATGTCTTGCTAGTCAAGTGACTTGATAATATAGCTTTCTATGAACTTTTTGCACTACATC
TCAGACATGTCTAATAATGTTTGTAATGTTGAGGGCAAGAAGACTATCACACCTTCCCAT
GTTGCTAAAGCACTCAAAGATTTGAAGATGGACAGTTACTTGTCAAAGATCCTAGAGTTG
GGTTTAGAAGATGGCGGGGAAGTTTAGCTTAGTGCGAAGGAGACTAAGGACATGATTTCT
CAGAAAATCTCAGGGGTCTAGTGTGGCAAGAAGAAAAAGAAGAGAGGAGGCAAGGGAGGC
ACAGACAATGGCATGACTGAGGAGGAGATGATCGCAGAGCAGCGAAGACTCTTTGATAGG
GCAAAGAACTATGACTATTCAGATGGAGAAAGAGGTAGTGACAACGATGAGCAGAATGAT
GAAAATGAAAGTGCAGGATCGAATGTGAACATGAACATGGAGCAATATCCAGGAGATTAA
CAGTAACAACAATACATGATGTAGAACCAGTATGATTATGCCAATCAACAGCAGTATACT
CTTGAGATGCAGTAGTAGATGATGTACTAGTAGCAGCAGTAGTTTATGTAGATGGATCCT
TAACAGCAGTAGTTGTACATGGAGCAACAAATGCTATACTTTTAACAATAGCAGCAGTTA
ATGTAACTTCAAGGCTATTCTATGCCAAACTAGTAAAGCCAAAATAGTTAAAACGATGCA
AAGCAAGATCAGTAGACAGTTCATAATAGTGCAGCTGGCAATGGTTCTTCTGCCCCTCCC
ACTATGAAACTTGGCATAAGCATGAGTGCAGCTTCTACAAGCAATCAGAGTGACAATAAG
TTGCTCCAAGACTACACTATGCAAATGAAGAAGATGAAATCTTAGAAGGATGTTGATGAT
ATGAACTTTGACGACGATGAAGAAGCTAAAGAGTGA


>Contig11427.0.g27(protein)
MESTNMNNKPQGKYDLTLSKSKSIPTATNPTFGPVDNEEYTLPRATLTQLIKEMLPAEMR
MSCQSSDLIIQLSMNFLHYISDMSNNVCNVEGKKTITPSHVAKALKDLKMDSYLSKILEL
GLEDGGEVQLSAKETKDMISQKISGVQCGKKKKKRGGKGGTDNGMTEEEMIAEQRRLFDR
AKNYDYSDGERGSDNDEQNDENESAGSNVNMNMEQYPGDQQQQQYMMQNQYDYANQQQYT
LEMQQQMMYQQQQQFMQMDPQQQQLYMEQQMLYFQQQQQLMQLQGYSMPNQQSQNSQNDA
KQDQQTVHNSAAGNGSSAPPTMKLGISMSAASTSNQSDNKLLQDYTMQMKKMKSQKDVDD
MNFDDDEEAKE