Identifiers and Description

Gene Model Identifier

Contig9799.0.g75

Standard Name

HAP3a

Aliases

Contig9799_0_g75

Description

Histone-like transcription factor (CBF/NF-Y) and archaeal histone

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00808 ) Histone-like transcription factor (CBF/NF-Y) and archaeal histone
  • ( pfam00125 ) Core histone H2A/H2B/H3/H4
  • ( pfam02269 ) Transcription initiation factor IID, 18kD subunit
  • ( pfam10846 ) Protein of unknown function (DUF2722)
  • ( pfam04147 ) Nop14-like family
  • ( pfam10446 ) Protein of unknown function (DUF2457)
  • ( pfam03344 ) Daxx Family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011946509.995739965151785e-43Histone-like transcription fac
tor (CBF/NF-Y) ...
SGDYBL021C1.0002335610448659e-38HAP3 SGDID:S000000117, Chr II
from 182094-181660, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9799.0.g75(coding)
ATGGAAGGACGTGGTGGAGGAGACGACGAAAATAAGGAATAAGATAGATACTTGCCAATT
GCAAATATAGGCCGCATAATGAAATCCGCATTACCGAAGGACGCCAAAATTGCCAAAGAA
GCCAGAGAGACTGTTCAAGAATGCGTTTCTGAGTTTATCTCGTTCATCACCAGCGAAGCC
TGTGATAAATGCAAGAATGACAAGCGTAAAACTATCAACGGAGAAGATCTGATATACTCG
TTATATCAATTGGGTTTCGAGCGCTACCTGGAGAATCTTCATTTATATTATGGAAAGTAT
AAGGCTGCTCAGAAACATAGTGATAAAGCTGAAATTAGTGGCAAAAACAATGATATTCTG
GTTAATAGTGCTCAGGAAGCTGTTCAGTAGAGGAAGTATCAGAAGAAGAATGCAGGTGGA
GACGACGATGAAGATGAAGAGGATGAGGAAGATATGGAAGATGATGAAGAAGACCTGGAA
GAGGATGAAGAGTAAGATGGAGATGACATGAGCATGAATGATGAAGATCCAGAATCTCAC
GATAAGAAACAGGGGAAGACTAAGAAAGCCAGTAAATAAGCTGAGAAGATCTGA


>Contig9799.0.g75(protein)
MEGRGGGDDENKEQDRYLPIANIGRIMKSALPKDAKIAKEARETVQECVSEFISFITSEA
CDKCKNDKRKTINGEDLIYSLYQLGFERYLENLHLYYGKYKAAQKHSDKAEISGKNNDIL
VNSAQEAVQQRKYQKKNAGGDDDEDEEDEEDMEDDEEDLEEDEEQDGDDMSMNDEDPESH
DKKQGKTKKASKQAEKI