Identifiers and Description

Gene Model Identifier

Contig93.1.g73

Standard Name

H4.2

Aliases

Contig93_1_g73

Description

Core histone H2A/H2B/H3/H4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00125 ) Core histone H2A/H2B/H3/H4
  • ( pfam02969 ) TATA box binding protein associated factor (TAF)
  • ( pfam00808 ) Histone-like transcription factor (CBF/NF-Y) and archaeal histone
  • ( pfam07524 ) Bromodomain associated
  • ( pfam02291 ) Transcription initiation factor IID, 31kD subunit
  • ( pfam02538 ) Hydantoinase B/oxoprolinase
  • ( pfam03847 ) Transcription initiation factor TFIID subunit A

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001891704.000820122464668e-47Histone H4, minor, putative
SGDYNL030W6.00092892288903e-46HHF2 SGDID:S000004975, Chr XIV
from 576727-577038, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig93.1.g73(coding)
ATGGCCGGAAGAGGTAAAGTAGGAAAAGGTTACGGTAAAGTCGGAGCCAAGAGACACACC
AAGAAGTCACTCAAGGAGACCATCATGGGCATCACCAAGCCAGCAATCAGAAGACTCGCC
AGAAGAGGTGGTGTCAAGAGAATCTCATCCCTCATCTATGAGGAGACCAGAAACGTTCTC
AGATCATTCCTCGAGAACGTGATCAGAGACTCAGTCACCTACACCGAACATGCCAAGAGA
AAGACCGTCACCGCTCTCGACGTCGTCTACGCTCTCAAGAGACAAGGCAGAACCCTCTAC
GGATTCGGTGGATGA


>Contig93.1.g73(protein)
MAGRGKVGKGYGKVGAKRHTKKSLKETIMGITKPAIRRLARRGGVKRISSLIYEETRNVL
RSFLENVIRDSVTYTEHAKRKTVTALDVVYALKRQGRTLYGFGG